DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5160 and Rap1

DIOPT Version :9

Sequence 1:NP_001188708.1 Gene:CG5160 / 34015 FlyBaseID:FBgn0031906 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001189023.1 Gene:Rap1 / 38244 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster


Alignment Length:194 Identity:59/194 - (30%)
Similarity:101/194 - (52%) Gaps:33/194 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KVMVLGQSGVGKTAMVVRFITRRFIGEYDPNLEKIYTCQTTLDKEQIQFDILDATG--QLQELDG 86
            |::|||..||||:|:.|:|:...|:.:|||.:|..|..|..:|.:|...:|||..|  |...:..
  Fly     5 KIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTEQFTAMRD 69

  Fly    87 VSLESNIRWADAFILMYSITDKCSFDECSRLKFLINYNKRRRKLGSASKEYAL------DIPVIL 145
            :.:::    ...|:|:||||.:.:|::...|                 :|..|      |:|::|
  Fly    70 LYMKN----GQGFVLVYSITAQSTFNDLQDL-----------------REQILRVKDTDDVPMVL 113

  Fly   146 VGNKTDQPGDRMVSLEEGQRRFRELSCSCFHEISVRESVDQVQNVFRDVFRFWRVFSKFPKLKR 209
            ||||.|...:|:|..|.|:....:.:|: |.|.|.:..|: |.::|.|:.|  ::..|.|:.|:
  Fly   114 VGNKCDLEEERVVGKELGKNLATQFNCA-FMETSAKAKVN-VNDIFYDLVR--QINKKSPEKKQ 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5160NP_001188708.1 small_GTPase 21..196 CDD:197466 55/179 (31%)
RERG_RasL11_like 24..200 CDD:206713 56/183 (31%)
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 56/184 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452988
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.