DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5160 and Ric

DIOPT Version :9

Sequence 1:NP_001188708.1 Gene:CG5160 / 34015 FlyBaseID:FBgn0031906 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001163165.1 Gene:Ric / 36776 FlyBaseID:FBgn0265605 Length:264 Species:Drosophila melanogaster


Alignment Length:209 Identity:60/209 - (28%)
Similarity:99/209 - (47%) Gaps:38/209 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KTLKVMVLGQSGVGKTAMVVRFITRRFIGEYDPNLEKIYTCQTTLDKEQIQFDILDATGQLQELD 85
            :..|:::||..||||:|:.::|::..|:..:||.:|..|..|..:|.|....||||..||::.. 
  Fly    58 RVYKIVILGDGGVGKSAVTLQFVSHSFLDYHDPTIEDSYQQQAVIDNEAALLDILDTAGQVEFT- 121

  Fly    86 GVSLESNIRWADAFILMYSITDKCSFDECSRLKFLINYNKRRRKLGSASKEYALDIPVILVGNKT 150
             ...:..:|..:.||:.||:||:.||.|.|..:.||.    |.:|..       |||::|:.||.
  Fly   122 -AMRDQYMRCGEGFIICYSVTDRHSFQEASEYRKLIT----RVRLSE-------DIPLVLIANKV 174

  Fly   151 DQPGDRMVSLEEGQRRFRELSCSCFH-EISVRESVDQV-QNVFRDV------------------- 194
            |....|.|:.|||:....:..|..|. ..::|..:|:. ..:.|::                   
  Fly   175 DLESQRRVTTEEGRNLANQFGCPFFETSAALRHYIDEAFYTLVREIRRKEMHKALGTDSNSEKIH 239

  Fly   195 ----FRFWRVFSKF 204
                .|:||:.|.|
  Fly   240 TGRRSRWWRIRSIF 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5160NP_001188708.1 small_GTPase 21..196 CDD:197466 55/199 (28%)
RERG_RasL11_like 24..200 CDD:206713 57/200 (29%)
RicNP_001163165.1 Rit_Rin_Ric 58..229 CDD:206712 55/183 (30%)
small_GTPase 58..223 CDD:197466 55/177 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452991
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D563049at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.