DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5160 and Eras

DIOPT Version :10

Sequence 1:NP_609112.1 Gene:CG5160 / 34015 FlyBaseID:FBgn0031906 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_853526.1 Gene:Eras / 353283 MGIID:2665023 Length:227 Species:Mus musculus


Alignment Length:129 Identity:30/129 - (23%)
Similarity:63/129 - (48%) Gaps:18/129 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KVMVLGQSGVGKTAMVVRFITRRFIGEYDPNLEKIYTCQTTLDKEQIQFDILDATGQLQELDGVS 88
            |.:|:|.|||||:|:.::...:.|:.::||.::..|..:...|......::||.:|  |::....
Mouse    43 KAVVVGASGVGKSALTIQMTHQCFVKDHDPTIQDSYWKEVARDNGGYILNVLDTSG--QDIHRAL 105

  Fly    89 LESNIRWADAFILMYSITDKCSFDECSRL-KFLINYNKRRRKLGSASKEYALDIPVILVGNKTD 151
            .:..:...|..:.::::.|..|.|:..:: .....::|:               |::|||||.|
Mouse   106 RDQCLASGDGVLGVFALDDPSSLDQLQQIWSTWTPHHKQ---------------PLVLVGNKCD 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5160NP_609112.1 RERG_RasL11_like 24..200 CDD:206713 30/129 (23%)
ErasNP_853526.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
P-loop containing Nucleoside Triphosphate Hydrolases 42..201 CDD:476819 30/129 (23%)
Effector region 70..78 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.