DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5160 and zgc:110699

DIOPT Version :9

Sequence 1:NP_001188708.1 Gene:CG5160 / 34015 FlyBaseID:FBgn0031906 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001018642.1 Gene:zgc:110699 / 325371 ZFINID:ZDB-GENE-050522-487 Length:211 Species:Danio rerio


Alignment Length:178 Identity:78/178 - (43%)
Similarity:105/178 - (58%) Gaps:21/178 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KVMVLGQSGVGKTAMVVRFITRRFIGEYDPNLEKIYTCQTTLDKEQIQFDILDATGQLQELDGV- 87
            |::|||:...||||:.||||||||||||:...|..|.||..:|||.|:.:|||...:    |.| 
Zfish    12 KLVVLGRDNCGKTALCVRFITRRFIGEYEHKREVNYRCQKIVDKEAIELEILDTVNK----DCVG 72

  Fly    88 ----SLESNIRWADAFILMYSITDKCSFDECSRLKFLINYNKRRRKLGSASKEYALDIPVILVGN 148
                ||||:|:|.|.|::|||:||:.||:..||||.||::.|:           .|.||.::|.|
Zfish    73 AAASSLESSIKWGDGFLIMYSVTDRSSFEAVSRLKRLIDHVKQ-----------TLGIPTVVVAN 126

  Fly   149 KTDQPGDRMVSLEEGQRRFRELSCSCFHEISVRESVDQVQNVFRDVFR 196
            |.|....|:|..:|||....:|.|| |.|:||.|....|:..|..:.|
Zfish   127 KCDMENGRVVRTDEGQALASDLRCS-FFELSVAEDASSVEAAFGQLVR 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5160NP_001188708.1 small_GTPase 21..196 CDD:197466 77/176 (44%)
RERG_RasL11_like 24..200 CDD:206713 78/178 (44%)
zgc:110699NP_001018642.1 RAS 12..177 CDD:214541 78/178 (44%)
RERG_RasL11_like 12..177 CDD:206713 78/178 (44%)
AAT_I <157..203 CDD:302748 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 134 1.000 Domainoid score I4987
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H80611
Inparanoid 1 1.050 134 1.000 Inparanoid score I4570
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384728at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24995
orthoMCL 1 0.900 - - OOG6_106704
Panther 1 1.100 - - O PTHR45704
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17345
SonicParanoid 1 1.000 - - X8978
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.860

Return to query results.
Submit another query.