DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5160 and Rasl12

DIOPT Version :9

Sequence 1:NP_001188708.1 Gene:CG5160 / 34015 FlyBaseID:FBgn0031906 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001101632.1 Gene:Rasl12 / 315762 RGDID:1306268 Length:266 Species:Rattus norvegicus


Alignment Length:221 Identity:72/221 - (32%)
Similarity:108/221 - (48%) Gaps:23/221 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LKVMVLGQSGVGKTAMVVRFITRRFIGEYDPNLEKIYTCQTTLDKEQIQFDILDATGQLQELDGV 87
            :.:.:||:.|.||:|:.|:|:|:|||.|||||||.||:.:.|:|.:.:...::|..    :||..
  Rat    21 VNLAILGRRGAGKSALTVKFLTKRFISEYDPNLEDIYSSEETVDHQPVHLRVMDTA----DLDTP 81

  Fly    88 -SLESNIRWADAFILMYSITDKCSFDECSRLKFLINYNKRRRKLGSASKEYALDIPVILVGNKTD 151
             :.|..:.||.||:::||:..:.||:..|....|         |...:||.....|.:|:|||.|
  Rat    82 RNCERYLNWAHAFLVVYSVDSRESFEGSSSYLEL---------LALHAKETQRGYPALLLGNKLD 137

  Fly   152 QPGDRMVSLEEGQRRFRELSCSCFHEISVRESVDQVQNVFRDVFR-FWRVFSKFPKLKR----ST 211
            ....|.|:..||........| .|.|:|.....:.||:||.:..| ..|...|.| |.|    |.
  Rat   138 MAQYRQVTKAEGAALAGRFGC-LFFEVSACLDFEHVQHVFHEAVREVRRELEKSP-LARPLFISE 200

  Fly   212 SDVANTDGILTPDSG--SCSFYDASS 235
            ....:....||...|  ||:|...|:
  Rat   201 EKALSHQTPLTARHGLASCTFNTLST 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5160NP_001188708.1 small_GTPase 21..196 CDD:197466 58/173 (34%)
RERG_RasL11_like 24..200 CDD:206713 59/177 (33%)
Rasl12NP_001101632.1 RERG_RasL11_like 22..185 CDD:206713 59/176 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384728at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.