DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5160 and Rasl11b

DIOPT Version :9

Sequence 1:NP_001188708.1 Gene:CG5160 / 34015 FlyBaseID:FBgn0031906 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001002830.1 Gene:Rasl11b / 305302 RGDID:1303099 Length:247 Species:Rattus norvegicus


Alignment Length:229 Identity:77/229 - (33%)
Similarity:124/229 - (54%) Gaps:28/229 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SPKSSLVKLGLHTNKQKTLKVMVLGQSGVGKTAMVVRFITRRFIGEYDPNLEKIYTCQTTLDKEQ 69
            :|.|:.....|....::.:|:.|:|.|||||||:||||:|:||||:|:.|...:||.|..::.|.
  Rat    15 APGSTAADCCLGAAGRRLVKIAVVGASGVGKTALVVRFLTKRFIGDYERNAGNLYTRQVHIEGET 79

  Fly    70 IQFDILDATG-QLQELDGVS----LESNIRWADAFILMYSITDKCSFDECSRLKFLINYNKRRRK 129
            :...:.|..| |:.| :|:|    |...||||||.::::||||..|::..|:|      ::..::
  Rat    80 LAIQVQDTPGIQVHE-NGLSCNEQLNRCIRWADAVVIVFSITDHKSYELISQL------HQHVQQ 137

  Fly   130 LGSASKEYALDIPVILVGNKTDQPGDRMVSLEEGQRRFRELSCSCFHEISVRESVDQVQNVFRDV 194
            |...::     :||::|.||.|....:.|..:.|.:....|.|| |:|:||.|:       :.||
  Rat   138 LHPGTR-----LPVVVVANKADLLHVKQVDPQLGLQLASMLGCS-FYEVSVSEN-------YNDV 189

  Fly   195 FRFWRVFSK--FPKLKRS-TSDVANTDGILTPDS 225
            :..:.|..|  .||.:.| |.:...|..|..|.|
  Rat   190 YSAFHVLCKEVSPKQQASGTPEKRRTSLIPRPKS 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5160NP_001188708.1 small_GTPase 21..196 CDD:197466 64/179 (36%)
RERG_RasL11_like 24..200 CDD:206713 64/180 (36%)
Rasl11bNP_001002830.1 Small GTPase-like 28..245 74/216 (34%)
RERG_RasL11_like 34..201 CDD:206713 66/186 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..229 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384728at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.