DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5160 and Rasl11a

DIOPT Version :9

Sequence 1:NP_001188708.1 Gene:CG5160 / 34015 FlyBaseID:FBgn0031906 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_006248896.1 Gene:Rasl11a / 304268 RGDID:1303231 Length:309 Species:Rattus norvegicus


Alignment Length:177 Identity:66/177 - (37%)
Similarity:101/177 - (57%) Gaps:17/177 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KTLKVMVLGQSGVGKTAMVVRFITRRFIGEYDPNLEKIYTCQTTLDKEQIQFDILDATGQLQELD 85
            |.:|:.|||.|.|||:||:|||:|:||||:|:||..|:|:....::.:|:...|.|..|.:|..|
  Rat    93 KDIKLAVLGASCVGKSAMIVRFLTKRFIGDYEPNTGKLYSRLVYVEGDQLSLQIQDTPGGIQAQD 157

  Fly    86 GV-----SLESNIRWADAFILMYSITDKCSFDECSRLKFLINYNKRRRKLGSASKEYALDIPVIL 145
            .:     ||...::||:.|:|:|||||   ::....::.|..:.::....|.|        ||::
  Rat   158 SLGQMVDSLSKCVQWAEGFLLVYSITD---YESYQSIRPLYQHIRKVHPDGKA--------PVVI 211

  Fly   146 VGNKTDQPGDRMVSLEEGQRRFRELSCSCFHEISVRESVDQVQNVFR 192
            ||||.|....|.|...||.:...||. |.|.|||..|:.:.|.:||:
  Rat   212 VGNKGDLLHARQVQTHEGLQLANELG-SLFLEISTSENYEDVCDVFQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5160NP_001188708.1 small_GTPase 21..196 CDD:197466 66/177 (37%)
RERG_RasL11_like 24..200 CDD:206713 65/174 (37%)
Rasl11aXP_006248896.1 small_GTPase 93..265 CDD:197466 66/177 (37%)
RERG_RasL11_like 96..265 CDD:206713 65/174 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384728at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.