DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5160 and Rit2

DIOPT Version :9

Sequence 1:NP_001188708.1 Gene:CG5160 / 34015 FlyBaseID:FBgn0031906 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001013078.1 Gene:Rit2 / 291713 RGDID:1307654 Length:217 Species:Rattus norvegicus


Alignment Length:202 Identity:69/202 - (34%)
Similarity:105/202 - (51%) Gaps:16/202 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GLHTNKQKTLKVMVLGQSGVGKTAMVVRFITRRFIGEYDPNLEKIYTCQTTLDKEQIQFDILDAT 78
            |..:...:..||::||..||||:|:.::||:.:|...:||.:|..|..|..:|.|....||||..
  Rat    12 GSSSGGSREYKVVMLGAGGVGKSAVTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTA 76

  Fly    79 GQLQELDGVSLESNIRWADAFILMYSITDKCSFDECSRLKFLINYNKRRRKLGSASKEYALDIPV 143
            ||.:..  ...|..:|..:.||:.||:||:.||.|.::.|.|| :..|          :..:||:
  Rat    77 GQAEFT--AMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELI-FQVR----------HTYEIPL 128

  Fly   144 ILVGNKTDQPGDRMVSLEEGQRRFRELSCSCFH-EISVRESVDQV-QNVFRDVFRFWRVFSKFP- 205
            :|||||.|....|.||.|||....|:.:|:.|. ..::|..:|.. |.:.|::.|...:.|... 
  Rat   129 VLVGNKIDLEQFRQVSTEEGMTLARDYNCAFFETSAALRFGIDDAFQGLVREIRRKESMLSLVER 193

  Fly   206 KLKRSTS 212
            ||||..|
  Rat   194 KLKRKDS 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5160NP_001188708.1 small_GTPase 21..196 CDD:197466 61/176 (35%)
RERG_RasL11_like 24..200 CDD:206713 62/177 (35%)
Rit2NP_001013078.1 Rit_Rin_Ric 19..190 CDD:206712 62/183 (34%)
small_GTPase 19..184 CDD:197466 61/177 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D563049at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.