DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5160 and W04C9.5

DIOPT Version :9

Sequence 1:NP_001188708.1 Gene:CG5160 / 34015 FlyBaseID:FBgn0031906 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_490735.3 Gene:W04C9.5 / 189184 WormBaseID:WBGene00021027 Length:369 Species:Caenorhabditis elegans


Alignment Length:232 Identity:53/232 - (22%)
Similarity:100/232 - (43%) Gaps:53/232 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ATSPKSSLVKLGLHTNKQKTLKVMVLGQSGVGKTAM---VVRFITRRFIGEY-------DPNLEK 57
            ||.|:..|.:...:...|..: :.|.|....||..:   :.:|.| |.:.:|       |....|
 Worm   152 ATCPEVWLFQETSNVPMQHVV-LRVYGSRNSGKKTLLSAINQFAT-RLVTQYNNESNEGDDTSSK 214

  Fly    58 IYTCQTTLDKEQIQFD-ILDATGQLQELDGVSLESNIRWADAFILMYSITDK----CSFDECSRL 117
              |....|:.|||:.: :|:||     |:.....|::   ..:.::|::.::    |:.|..|| 
 Worm   215 --TMNFLLNNEQIELEMLLEAT-----LENSPFASSL---TMYAIVYNVDNRESFVCATDLLSR- 268

  Fly   118 KFLINYNKRRRKLGSASKEYALDIPVILVGNKTDQPGDRMVSLEEGQRRFRELSCSCFHEISVRE 182
              |:|     ||:...:.       :||:|||.|...:.:||..||....:...|: |.|:|.:.
 Worm   269 --LLN-----RKIARGAN-------IILIGNKIDLKRNTVVSKMEGACLAKVHKCN-FVEVSAQY 318

  Fly   183 SVDQVQNVFRDVFRFWRVFSKFPKLKRSTSDVANTDG 219
            |:        ::...|.:..|  :|:...:::...:|
 Worm   319 SM--------NISELWTIILK--QLQAPKAELEEPNG 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5160NP_001188708.1 small_GTPase 21..196 CDD:197466 44/189 (23%)
RERG_RasL11_like 24..200 CDD:206713 45/190 (24%)
W04C9.5NP_490735.3 P-loop_NTPase 171..333 CDD:304359 46/199 (23%)
Ras 177..333 CDD:278499 45/192 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384728at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.