DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5160 and rerg

DIOPT Version :9

Sequence 1:NP_001188708.1 Gene:CG5160 / 34015 FlyBaseID:FBgn0031906 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001314766.1 Gene:rerg / 101882104 ZFINID:ZDB-GENE-131018-1 Length:203 Species:Danio rerio


Alignment Length:161 Identity:67/161 - (41%)
Similarity:98/161 - (60%) Gaps:15/161 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KQKTLKVMVLGQSGVGKTAMVVRFITRRFIGEYDPNLEKIYTCQTTLDKEQIQFDILDATGQLQE 83
            |...:|:.|.|::||||:|:||||:|:|||.||||.||..|..|..:|.|.:..:|||..||   
Zfish     3 KSPEVKLAVFGRAGVGKSALVVRFLTKRFIWEYDPTLESTYRHQANIDDEPVSMEILDTAGQ--- 64

  Fly    84 LDGVSLESNIRWADAFILMYSITDKCSFDECSRLKFLINYNKRRRKLGSASKEYALDIPVILVGN 148
            .|.:..||::||.|.|||:|.|||:.||::.:.||.|:...||.:           .:|::|:||
Zfish    65 EDVLQRESHMRWGDGFILVYDITDRGSFEDVAPLKGLLEDLKRPK-----------HVPLVLLGN 118

  Fly   149 KTDQPGDRMVSLEEGQRRFRELSCSCFHEIS 179
            |.|....|.|...||:|...:::|: |:|.|
Zfish   119 KADLEHARQVGTAEGERLAADMACA-FYECS 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5160NP_001188708.1 small_GTPase 21..196 CDD:197466 66/159 (42%)
RERG_RasL11_like 24..200 CDD:206713 66/156 (42%)
rergNP_001314766.1 small_GTPase 5..174 CDD:197466 66/159 (42%)
RERG_RasL11_like 8..173 CDD:206713 66/156 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384728at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24995
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.