DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5160 and rergl

DIOPT Version :9

Sequence 1:NP_001188708.1 Gene:CG5160 / 34015 FlyBaseID:FBgn0031906 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_017947954.1 Gene:rergl / 100491594 XenbaseID:XB-GENE-6037390 Length:235 Species:Xenopus tropicalis


Alignment Length:179 Identity:70/179 - (39%)
Similarity:100/179 - (55%) Gaps:22/179 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TLK----VMVLGQSGVGKTAMVVRFITRRFIGEYDPNLEKIYTCQTTLDKEQIQFDILD---ATG 79
            |||    ::|||..||||:|:.|||:||||||||. .||.||:....:|.:::.|:|.|   |..
 Frog    31 TLKMEANILVLGADGVGKSALTVRFLTRRFIGEYG-ELESIYSHNVCVDGKEVIFNIWDFPYAKD 94

  Fly    80 QLQELDGVSLESNIRWADAFILMYSITDKCSFD-ECSRLKFLINYNKRRRKLGSASKEYALDIPV 143
            ..:| .....|..::|||.::|:|||.|:.||: .|..::.:    |..:....|.|     :|:
 Frog    95 PTEE-SCAEEEKRMQWADGYVLVYSICDRASFNVMCQTIQLI----KTAKDCLGAEK-----LPI 149

  Fly   144 ILVGNKTDQPGDRMVSLEEGQRRFRELSCSC-FHEISVRESVDQVQNVF 191
            ::||||.|....|.||.|||  |...||..| |:|:|..|:...|..||
 Frog   150 VIVGNKRDLHHLRAVSSEEG--RLLALSMDCDFYEVSAAEAYHGVLMVF 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5160NP_001188708.1 small_GTPase 21..196 CDD:197466 70/179 (39%)
RERG_RasL11_like 24..200 CDD:206713 68/177 (38%)
rerglXP_017947954.1 P-loop_NTPase 37..205 CDD:393306 67/173 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384728at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.