DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5160 and rit1

DIOPT Version :9

Sequence 1:NP_001188708.1 Gene:CG5160 / 34015 FlyBaseID:FBgn0031906 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_031747350.1 Gene:rit1 / 100486360 XenbaseID:XB-GENE-5777077 Length:183 Species:Xenopus tropicalis


Alignment Length:196 Identity:64/196 - (32%)
Similarity:89/196 - (45%) Gaps:34/196 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 MVVRFITRRFIGEYDPNLEKIYTCQTTLDKEQIQFDILDATGQLQELDGVSLESNIRWADAFILM 102
            |.::||:.||..::||.:|..|..:..:|.|....||||..||.:..  ...:..:|..:.||:.
 Frog     1 MTMQFISHRFPEDHDPTIEDAYKMRIRIDDEPANLDILDTAGQAEFT--AMRDQYMRAGEGFIIC 63

  Fly   103 YSITDKCSFDECSRLKFLINYNKRRRKLGSASKEYALDIPVILVGNKTDQPGDRMVSLEEGQRRF 167
            |||||:.||.|....|.|| |..||..          |.||:|||||:|....|.||.|||....
 Frog    64 YSITDRRSFHEARDFKQLI-YRVRRTD----------DTPVVLVGNKSDLSRLRQVSKEEGSSLA 117

  Fly   168 RELSCSCFH-EISVRESVDQV-QNVFRDVFR------------------FW-RVFSKFPKLKRST 211
            ||.:|..|. ..:.|..:|.| ..:.|::.|                  .| |:.|.|.:.|.|.
 Frog   118 REFNCPFFETSAAFRYYIDDVFHALVREIRRKEREAALANERKLKPRATLWKRLKSPFRRKKDSV 182

  Fly   212 S 212
            :
 Frog   183 T 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5160NP_001188708.1 small_GTPase 21..196 CDD:197466 57/159 (36%)
RERG_RasL11_like 24..200 CDD:206713 59/182 (32%)
rit1XP_031747350.1 P-loop_NTPase 1..155 CDD:422963 58/166 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D563049at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.