DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5160 and XB877260

DIOPT Version :9

Sequence 1:NP_001188708.1 Gene:CG5160 / 34015 FlyBaseID:FBgn0031906 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001120277.1 Gene:XB877260 / 100145332 XenbaseID:XB-GENE-877261 Length:218 Species:Xenopus tropicalis


Alignment Length:189 Identity:81/189 - (42%)
Similarity:117/189 - (61%) Gaps:16/189 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LKVMVLGQSGVGKTAMVVRFITRRFIGEYDPNLEKIYTCQTTLDKEQIQFDILDATGQLQELDGV 87
            ::::|||||.|||||:.|||||:||||:|||.||.||.....:|.|.:.|:|||..|  ||.|.:
 Frog     1 MRIVVLGQSAVGKTALTVRFITKRFIGDYDPTLEMIYRHTAAIDGEYVHFEILDTAG--QEEDSL 63

  Fly    88 SLESNIRWADAFILMYSITDKCSFDECSRLKFLINYNKRRRKLGSASKEYALDIPVILVGNKTDQ 152
            .:|..|:|.|.|.::||:||:|||||..||.||||:.....:.|:....     ||::|.||.|.
 Frog    64 QIEEKIKWGDGFAVVYSVTDRCSFDEVMRLCFLINHVHSNARKGAGELP-----PVVIVANKKDL 123

  Fly   153 PGDRMVSLEEGQRRFRELSCSCFHEISVRESVDQVQNVFRDVFRFWRVFSKFPKLKRST 211
            ..||||:.:||::..:.|...|: |||.|:|.::...||.:::        :..||:.|
 Frog   124 EFDRMVTTDEGEKLSKSLKYPCY-EISTRDSYEETALVFNNLY--------YDLLKQGT 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5160NP_001188708.1 small_GTPase 21..196 CDD:197466 78/172 (45%)
RERG_RasL11_like 24..200 CDD:206713 78/175 (45%)
XB877260NP_001120277.1 small_GTPase 2..171 CDD:197466 79/184 (43%)
P-loop_NTPase 3..164 CDD:304359 78/168 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4450
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H80611
Inparanoid 1 1.050 157 1.000 Inparanoid score I4179
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384728at2759
OrthoFinder 1 1.000 - - FOG0014289
OrthoInspector 1 1.000 - - oto104339
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17345
SonicParanoid 1 1.000 - - X8978
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.