Sequence 1: | NP_001188708.1 | Gene: | CG5160 / 34015 | FlyBaseID: | FBgn0031906 | Length: | 328 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_031753456.1 | Gene: | rerg / 100134997 | XenbaseID: | XB-GENE-489597 | Length: | 228 | Species: | Xenopus tropicalis |
Alignment Length: | 207 | Identity: | 70/207 - (33%) |
---|---|---|---|
Similarity: | 104/207 - (50%) | Gaps: | 44/207 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 KQKTLKVMVLGQSGVGKT-----------------------------AMVVRFITRRFIGEYDPN 54
Fly 55 LEKIYTCQTTLDKEQIQFDILDATGQLQELDGVSLESNIRWADAFILMYSITDKCSFDECSRLKF 119
Fly 120 LINYNKRRRKLGSASKEYALDIPVILVGNKTDQPGDRMVSLEEGQRRFRELSCSCFHEISVRESV 184
Fly 185 DQVQNVFRDVFR 196 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5160 | NP_001188708.1 | small_GTPase | 21..196 | CDD:197466 | 68/203 (33%) |
RERG_RasL11_like | 24..200 | CDD:206713 | 69/202 (34%) | ||
rerg | XP_031753456.1 | RERG_RasL11_like | 8..198 | CDD:206713 | 69/202 (34%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1384728at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.920 |