DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gudu and VAC8

DIOPT Version :9

Sequence 1:NP_609111.1 Gene:gudu / 34014 FlyBaseID:FBgn0031905 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_010903.3 Gene:VAC8 / 856702 SGDID:S000000739 Length:578 Species:Saccharomyces cerevisiae


Alignment Length:539 Identity:129/539 - (23%)
Similarity:213/539 - (39%) Gaps:111/539 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 SILKTPRDQ--LSP----------------DDLESLDMTRAG-ARALFTLADSKHNMEQMRKSGI 251
            |.||...|:  :||                :|.:.||....| .:||.||..| .|:...|.:.:
Yeast     6 SCLKDSSDEASVSPIADNEREAVTLLLGYLEDKDQLDFYSGGPLKALTTLVYS-DNLNLQRSAAL 69

  Fly   252 VPLMAQLLKSCHIDVVIPIMGTVRKCSSEPKFQLAITTEGMIPDIVSHLSSENTELKMEGSTAIY 316
            .  .|::.:.           .||:.|.|           ::..|:..|.|::.::::....|:.
Yeast    70 A--FAEITEK-----------YVRQVSRE-----------VLEPILILLQSQDPQIQVAACAALG 110

  Fly   317 KCAFDGTTRDLVREAGGLEPLVTIIKDKNVRENKPLLRGATGAIWMCAVTDANVKVLDQLRTVNH 381
            ..|.:...:.|:.|.||||||:..:...||.    :...|.|.|...|..|.|...:.....:..
Yeast   111 NLAVNNENKLLIVEMGGLEPLINQMMGDNVE----VQCNAVGCITNLATRDDNKHKIATSGALIP 171

  Fly   382 LVALLNDECDEVLTNVTGAISECVRFQSNREQLRQAGGLPAMVSLLNSSHAPLLENLAKGLKECA 446
            |..|...:...|..|.|||:......:.||::|..||.:|.:||||:|:...:.......|...|
Yeast   172 LTKLAKSKHIRVQRNATGALLNMTHSEENRKELVNAGAVPVLVSLLSSTDPDVQYYCTTALSNIA 236

  Fly   447 EDPDSMRILEDLD--AVRLIWSLLKNPTTRVQAHAAYAICPCVRN-ANDSA---ELVRSLVGAME 505
            .|..:.:.|...:  .|..:.||:.:|::||:..|..|:    || |:|::   |:||:  |.:.
Yeast   237 VDEANRKKLAQTEPRLVSKLVSLMDSPSSRVKCQATLAL----RNLASDTSYQLEIVRA--GGLP 295

  Fly   506 LVVGLLKSKDIMVLSAVCAAIATIAQDQTNLAILTD---LKVIYKLADLVQTTD------DLLRM 561
            .:|.|::|..|.::.|..|.|..|:....|..::.|   ||.:.:|.|...:.:      ..|| 
Yeast   296 HLVKLIQSDSIPLVLASVACIRNISIHPLNEGLIVDAGFLKPLVRLLDYKDSEEIQCHAVSTLR- 359

  Fly   562 NLAA-------------AVAAC----------------ACFG----NNTEELGRLRT--VTPIVT 591
            ||||             ||..|                |||.    .:..:|..|..  :..::.
Yeast   360 NLAASSEKNRKEFFESGAVEKCKELALDSPVSVQSEISACFAILALADVSKLDLLEANILDALIP 424

  Fly   592 YMTSDNPLVHRSTAMALEKLSMDPQNCITMHQS------GVVPFLLECIGSTNKELQLAAAGCLR 650
            ...|.|..|..:.|.||..|.....|...:.::      |:..||:..:.|.....:..|...:.
Yeast   425 MTFSQNQEVSGNAAAALANLCSRVNNYTKIIEAWDRPNEGIRGFLIRFLKSDYATFEHIALWTIL 489

  Fly   651 NIRELALRAEEYLLKIDDD 669
            .:.|......|.|:|.|||
Yeast   490 QLLESHNDKVEDLVKNDDD 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
guduNP_609111.1 armadillo repeat 105..134 CDD:293788
armadillo repeat 144..180 CDD:293788
Arm_3 214..557 CDD:330530 91/376 (24%)
armadillo repeat 245..275 CDD:293788 2/29 (7%)
armadillo repeat 286..318 CDD:293788 4/31 (13%)
armadillo repeat 328..362 CDD:293788 12/33 (36%)
armadillo repeat 411..447 CDD:293788 11/35 (31%)
armadillo repeat 453..484 CDD:293788 9/32 (28%)
armadillo repeat 494..526 CDD:293788 10/34 (29%)
ARM 614..652 CDD:214547 6/43 (14%)
armadillo repeat 619..652 CDD:293788 5/38 (13%)
VAC8NP_010903.3 SRP1 42..>358 CDD:227396 87/350 (25%)
armadillo repeat 119..155 CDD:293788 13/39 (33%)
armadillo repeat 160..194 CDD:293788 7/33 (21%)
armadillo repeat 204..235 CDD:293788 10/30 (33%)
armadillo repeat 242..280 CDD:293788 11/41 (27%)
armadillo repeat 286..319 CDD:293788 11/34 (32%)
armadillo repeat 326..361 CDD:293788 7/35 (20%)
armadillo repeat 369..402 CDD:293788 6/32 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2332
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.