DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gudu and ARIA

DIOPT Version :10

Sequence 1:NP_609111.1 Gene:gudu / 34014 FlyBaseID:FBgn0031905 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_850852.1 Gene:ARIA / 832053 AraportID:AT5G19330 Length:710 Species:Arabidopsis thaliana


Alignment Length:53 Identity:15/53 - (28%)
Similarity:21/53 - (39%) Gaps:4/53 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 YPTLVIRGTGLYELWKTGRYKSYPPSTLVDLVAKILALVPPWTRVYRV-QRDI 371
            :.:|.:...||...  .....||.||.:...:.... |.|.|..||.: |.||
plant    61 FSSLYVSNNGLLSF--NASIGSYVPSNVTSSLGNPF-LAPFWADVYNINQGDI 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
guduNP_609111.1 armadillo repeat 105..134 CDD:293788
armadillo repeat 144..180 CDD:293788
VRR_NUC <172..232 CDD:451466
SRP1 214..557 CDD:227396 15/53 (28%)
armadillo repeat 245..275 CDD:293788
armadillo repeat 286..318 CDD:293788
armadillo repeat 328..362 CDD:293788 8/33 (24%)
armadillo repeat 411..447 CDD:293788
armadillo repeat 453..484 CDD:293788
armadillo repeat 494..526 CDD:293788
Arm 614..652 CDD:425727
armadillo repeat 619..652 CDD:293788
ARIANP_850852.1 PLN03200 121..>353 CDD:215629
armadillo repeat 144..183 CDD:293788
armadillo repeat 194..225 CDD:293788
armadillo repeat 233..269 CDD:293788
armadillo repeat 275..306 CDD:293788
armadillo repeat 317..351 CDD:293788
BTB_POZ_ARIA_plant 528..643 CDD:349661
BACK_ARIA_like 637..700 CDD:350579
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.