| Sequence 1: | NP_609111.1 | Gene: | gudu / 34014 | FlyBaseID: | FBgn0031905 | Length: | 669 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_850852.1 | Gene: | ARIA / 832053 | AraportID: | AT5G19330 | Length: | 710 | Species: | Arabidopsis thaliana |
| Alignment Length: | 53 | Identity: | 15/53 - (28%) |
|---|---|---|---|
| Similarity: | 21/53 - (39%) | Gaps: | 4/53 - (7%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 320 YPTLVIRGTGLYELWKTGRYKSYPPSTLVDLVAKILALVPPWTRVYRV-QRDI 371 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| gudu | NP_609111.1 | armadillo repeat | 105..134 | CDD:293788 | |
| armadillo repeat | 144..180 | CDD:293788 | |||
| VRR_NUC | <172..232 | CDD:451466 | |||
| SRP1 | 214..557 | CDD:227396 | 15/53 (28%) | ||
| armadillo repeat | 245..275 | CDD:293788 | |||
| armadillo repeat | 286..318 | CDD:293788 | |||
| armadillo repeat | 328..362 | CDD:293788 | 8/33 (24%) | ||
| armadillo repeat | 411..447 | CDD:293788 | |||
| armadillo repeat | 453..484 | CDD:293788 | |||
| armadillo repeat | 494..526 | CDD:293788 | |||
| Arm | 614..652 | CDD:425727 | |||
| armadillo repeat | 619..652 | CDD:293788 | |||
| ARIA | NP_850852.1 | PLN03200 | 121..>353 | CDD:215629 | |
| armadillo repeat | 144..183 | CDD:293788 | |||
| armadillo repeat | 194..225 | CDD:293788 | |||
| armadillo repeat | 233..269 | CDD:293788 | |||
| armadillo repeat | 275..306 | CDD:293788 | |||
| armadillo repeat | 317..351 | CDD:293788 | |||
| BTB_POZ_ARIA_plant | 528..643 | CDD:349661 | |||
| BACK_ARIA_like | 637..700 | CDD:350579 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||