DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gudu and AT2G45720

DIOPT Version :9

Sequence 1:NP_609111.1 Gene:gudu / 34014 FlyBaseID:FBgn0031905 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001031543.1 Gene:AT2G45720 / 819180 AraportID:AT2G45720 Length:553 Species:Arabidopsis thaliana


Alignment Length:599 Identity:117/599 - (19%)
Similarity:218/599 - (36%) Gaps:152/599 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 VLVNILECSDTKCCLGALKVLSDITLNIDIRKTIVDLDGIPLIVDILNSSMKDLKTMAAETLANV 178
            |:::.||...|  |      |||::.:....|..:..:.:..:::.|..:::         ||||
plant    46 VIISRLEKIPT--C------LSDLSSHPCFSKHTLCKEQLQAVLETLKETIE---------LANV 93

  Fly   179 CKVRLARKYVRTCGGIPKLVDLIDIKLS----ILKT--------PRDQLSPDDLESLDMTRAGAR 231
            |........::....:..|...||:.|.    ::||        |... |..|||:..:....||
plant    94 CVSEKQEGKLKMQSDLDSLSAKIDLSLKDCGLLMKTGVLGEVTKPLSS-STQDLETFSVRELLAR 157

  Fly   232 ALFTLADSKHN--------MEQMRKSGIVPL-------MAQLLKSCHIDVVIPIMGTVRKCSSEP 281
            ......:||..        |::..|:.|..|       :.|||.:....|....:..:...:...
plant   158 LQIGHLESKRKALEQLVEVMKEDEKAVITALGRTNVASLVQLLTATSPSVRENAVTVICSLAESG 222

  Fly   282 KFQLAITTEGMIPDIVSHLSSENTELKMEGSTAIYKCAFDGTTRDLVREAGGLEPLVTIIKDKNV 346
            ..:..:.:|..:|.::..|.|.:...|.:...::.:.:....|...:...||:.||:.|      
plant   223 GCENWLISENALPSLIRLLESGSIVAKEKAVISLQRMSISSETSRSIVGHGGVGPLIEI------ 281

  Fly   347 RENKPLLRGATGAIWMCAVTDANVKVLDQLRTVNHLVALLNDECDEVLTNVTGAISECVRFQSNR 411
                            |...|:              |:.....|  .|.|:: |:.|.      |
plant   282 ----------------CKTGDS--------------VSQSASAC--TLKNIS-AVPEV------R 307

  Fly   412 EQLRQAGGLPAMVSLLNSSHAPLLENLAKGLKECAEDPDSMRILEDLDAVRLIWSLLKNPTTR-- 474
            :.|.:.|.:..|:::||.       .:..|.||.|.:     .|::|.:        .|.|.|  
plant   308 QNLAEEGIVKVMINILNC-------GILLGSKEYAAE-----CLQNLTS--------SNETLRRS 352

  Fly   475 ------VQAHAAYAICPCVRNANDSAELVRSLVGAMEL---------VVGLLKSKDIMVLSAVCA 524
                  :|...||...|..:.:..:|  :|:|||::.:         :|.:|||..|....|..:
plant   353 VISENGIQTLLAYLDGPLPQESGVAA--IRNLVGSVSVETYFKIIPSLVHVLKSGSIGAQQAAAS 415

  Fly   525 AIATIAQDQTNLAILTDLKVIYKLADLVQTTDDLLRMNLAAAVAACACFGNNTEELGR-LRTVTP 588
            .|..||.......::.:...|..|..:::......|...|.|:|:......|..|:.| .::||.
plant   416 TICRIATSNETKRMIGESGCIPLLIRMLEAKASGAREVAAQAIASLVTVPRNCREVKRDEKSVTS 480

  Fly   589 IVTYMTSDNPLVHRSTAMALEKLSMDPQNCITMHQSGVVPFLLECIGSTNKELQLA--AAGCLRN 651
            :|.       |:..|...:.:|.::          ||:...   |.....|:|.::  |.|.|:.
plant   481 LVM-------LLEPSPGNSAKKYAV----------SGLAAL---CSSRKCKKLMVSHGAVGYLKK 525

  Fly   652 IRELALRAEEYLLK 665
            :.||.:...:.||:
plant   526 LSELEVPGSKKLLE 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
guduNP_609111.1 armadillo repeat 105..134 CDD:293788 5/19 (26%)
armadillo repeat 144..180 CDD:293788 6/35 (17%)
Arm_3 214..557 CDD:330530 70/374 (19%)
armadillo repeat 245..275 CDD:293788 7/36 (19%)
armadillo repeat 286..318 CDD:293788 5/31 (16%)
armadillo repeat 328..362 CDD:293788 5/33 (15%)
armadillo repeat 411..447 CDD:293788 9/35 (26%)
armadillo repeat 453..484 CDD:293788 8/38 (21%)
armadillo repeat 494..526 CDD:293788 11/40 (28%)
ARM 614..652 CDD:214547 8/39 (21%)
armadillo repeat 619..652 CDD:293788 8/34 (24%)
AT2G45720NP_001031543.1 PLN03200 <189..>508 CDD:215629 74/405 (18%)
armadillo repeat 269..300 CDD:293788 10/68 (15%)
armadillo repeat 307..344 CDD:293788 12/48 (25%)
armadillo repeat 395..420 CDD:293788 7/24 (29%)
armadillo repeat 427..463 CDD:293788 6/35 (17%)
armadillo repeat 469..501 CDD:293788 9/48 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0167
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.