DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gudu and Armc3

DIOPT Version :9

Sequence 1:NP_609111.1 Gene:gudu / 34014 FlyBaseID:FBgn0031905 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_036018461.1 Gene:Armc3 / 70882 MGIID:1918132 Length:885 Species:Mus musculus


Alignment Length:604 Identity:121/604 - (20%)
Similarity:232/604 - (38%) Gaps:108/604 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 IVSLCC--LKDYDLSTQINQFAISDIGGLDVLVNILECSDTKCCLGALKVLSDITLNIDIRKTIV 148
            |::..|  :..:.|..:.|:..:.::|.::.|..:|...|......|:.:...:..|.|::|.:.
Mouse    41 ILAKACEAIYKFALKGEENKATLLELGAVEPLTKLLTHEDKTVRRNAMMIFGILASNSDVKKLLR 105

  Fly   149 DLDGIPLIVDILNSSMKDL---KTMAAETLANVCKVRLARKY-----VRTCGGIPKLVDLIDIKL 205
            :|       :::||.:..|   :.:.....|::|...::.:|     :...||:..|:.|     
Mouse   106 EL-------EVMNSVIAQLSPEEEVVIHEFASLCLANMSVEYTGKVQIFEHGGLEPLIRL----- 158

  Fly   206 SILKTPRDQLSPDDLESLDMTRAGARALFTLADSKHNMEQMRKSGIVPLMAQLLKSCHIDVVIPI 270
                     ||..|   .|:.:.....::.|.........:::...:|.:.:||:|.:..:.:..
Mouse   159 ---------LSSSD---PDVKKNSIECIYNLVQDFQCRTTLQELNAIPPILELLRSEYPIIQLLA 211

  Fly   271 MGT--VRKCSSEPKFQLAITTEGMIPDIVSHL-----SSENTELKMEGSTAIYKCAFDGTTRDLV 328
            :.|  |..|..|.:..|. ..:|:     .||     :.|..:|.:|..:.|..|..|..|..|:
Mouse   212 LKTLGVITCDKEARTMLK-ENQGL-----DHLTKILETKELNDLHVEALSVIANCLEDMDTMVLM 270

  Fly   329 REAGGLEPLVTIIKDKNVRENKPLLRGATGAIWMCAVTDANVKVLDQLRTVNHLVALLNDECDEV 393
            ::.|.|:.:::..:...:.:   :.:.|..||...|....|.||..:......||.||..:.|..
Mouse   271 QQTGSLKKVLSFAESSTIPD---IQKNAAKAIAKAAYDPENRKVFHEQEVEKCLVTLLGSDSDGT 332

  Fly   394 LTNVTGAIS------ECVRFQSNREQLRQAGGLPAMVSLLNSSHAPLLENLAKGLKECAEDPDSM 452
            ....:.|||      .|..|.:.:       |:|.:|.||.|.:..:.|..|..           
Mouse   333 KIAASQAISALCENLSCKEFFNTQ-------GIPQIVQLLRSDNEEVREAAALA----------- 379

  Fly   453 RILEDLDAVRLIWSLLKNPTTRVQAHAAYAICPCVRNANDSAELVRSLVGAMELVVGLLKSKDIM 517
                           |.|.||...|           |||.:||     ..|::.::.:|.||...
Mouse   380 ---------------LANLTTSSPA-----------NANAAAE-----ADAIDPLINILSSKRDG 413

  Fly   518 VLSAVCAAIATIAQDQTNLAILTDLKVIYKLADLVQTTDDLLRMNLAAAVAACACFGNNTEELGR 582
            .::.....:..:|..:...||:.:.::::.|...:.:|:.|::...|..|||.||......:|..
Mouse   414 AIANAATVLTNMATQEPLRAIIQNHEIMHALLGPLHSTNTLVQSTAALTVAATACDVEARTQLRN 478

  Fly   583 LRTVTPIVTYMTSDNPLVHRSTAMALEKLSMDPQNCITMHQSGVVPFLLE---CIGSTNKELQLA 644
            ...:.|:|..:.|.|..|.|..:.|:...:.|....:.:.:.|.:..|.|   .:...||..:.|
Mouse   479 CGGLVPLVGLLHSKNDEVRRHASWAVMVCAGDEPMAVELCRLGALNILEEINRSLSRKNKFSEAA 543

  Fly   645 AAGCLRNIRELALRAEEYL 663
            ....|.|...|......||
Mouse   544 YNKLLNNNLSLKYSQTGYL 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
guduNP_609111.1 armadillo repeat 105..134 CDD:293788 5/28 (18%)
armadillo repeat 144..180 CDD:293788 6/38 (16%)
Arm_3 214..557 CDD:330530 71/355 (20%)
armadillo repeat 245..275 CDD:293788 5/31 (16%)
armadillo repeat 286..318 CDD:293788 7/36 (19%)
armadillo repeat 328..362 CDD:293788 5/33 (15%)
armadillo repeat 411..447 CDD:293788 8/35 (23%)
armadillo repeat 453..484 CDD:293788 5/30 (17%)
armadillo repeat 494..526 CDD:293788 6/31 (19%)
ARM 614..652 CDD:214547 8/40 (20%)
armadillo repeat 619..652 CDD:293788 7/35 (20%)
Armc3XP_036018461.1 armadillo repeat 22..52 CDD:293788 2/10 (20%)
PLN03200 <32..>182 CDD:215629 28/164 (17%)
armadillo repeat 60..96 CDD:293788 5/35 (14%)
armadillo repeat 104..136 CDD:293788 6/38 (16%)
Arm 143..178 CDD:395413 8/51 (16%)
armadillo repeat 143..177 CDD:293788 8/50 (16%)
armadillo repeat 184..218 CDD:293788 5/33 (15%)
armadillo repeat 225..259 CDD:293788 8/39 (21%)
armadillo repeat 319..343 CDD:293788 8/23 (35%)
armadillo repeat 350..385 CDD:293788 11/67 (16%)
SRP1 <358..>504 CDD:227396 40/187 (21%)
armadillo repeat 391..425 CDD:293788 8/38 (21%)
ARM 469..504 CDD:214547 7/34 (21%)
armadillo repeat 473..503 CDD:293788 7/29 (24%)
EDR1 <754..871 CDD:405130
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0167
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2332
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.