DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gudu and armc5

DIOPT Version :9

Sequence 1:NP_609111.1 Gene:gudu / 34014 FlyBaseID:FBgn0031905 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_021329768.1 Gene:armc5 / 569910 ZFINID:ZDB-GENE-030131-7382 Length:1218 Species:Danio rerio


Alignment Length:471 Identity:105/471 - (22%)
Similarity:178/471 - (37%) Gaps:123/471 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 KYIKAGNQTATIVSLCCLKDYDLSTQINQFAISDI------GGLDVLVNILEC--SDTKCCLGAL 131
            |.:|||...|.:.         :.||..:...|.|      ||:..|:::|..  |..|....||
Zfish    66 KRLKAGQWRALVA---------IRTQHIKGGGSRIARYQSRGGIPPLLDLLRRPESSRKFVDLAL 121

  Fly   132 KVLSDITLNIDIRKTIVDLDGIPLIVDIL--NSSMKDLKTMAAETLANVCKVRLARKYVRTCGGI 194
            .:|::.......|..:..|||:.::||:|  |.|::.::..||..|.|:.........|.:.||:
Zfish   122 SILANCCTEKGTRLQVRKLDGVSVVVDVLKRNVSVETVQNRAARALGNLAMDPEGSSEVHSAGGV 186

  Fly   195 PKLVDLIDIK--------LSILKTPRDQLSPDDLESLDMTRAGARALFTLADSKHNMEQMRKSGI 251
            |.|:..:.:.        .|:  ||..:|....:|.:   ::.||||..|:|:..|...:...|.
Zfish   187 PLLLLCLSVSPPPPPSSPSSV--TPASELCAPKVECV---QSAARALVYLSDTPANRLLLLSQGA 246

  Fly   252 VPLMAQL-------------LKSCHIDVVIPIMGTVRKCSSE----------------------- 280
            :|.:||.             |::.|        ...|.||:|                       
Zfish   247 LPALAQFISPEYPAGLQRASLRALH--------ELTRGCSAECAREMSRSGALTQLGVLASGEDG 303

  Fly   281 -PKFQLAITT------EGMIPDIVSHLS-----SENTELKMEGSTAIYK----CAFDGTTRDLVR 329
             |..:||:.|      :|.:..:|..|.     :|..:.....|:..:|    |..:...|..|:
Zfish   304 RPLEELALKTLANMCSQGSLRPLVGSLGVIQKFAEEVKKDPLRSSVFFKALCLCCREAVNRAKVK 368

  Fly   330 EAGGLEPLVTIIKDKNVRENKPLLRGATGAIWMCAVTDANVKVLDQLR-------TVNHLVALLN 387
            |:||||.|::.:   :..:|.||.|.|..|   |.....:...|:||:       .:..||.|..
Zfish   369 ESGGLEVLISFL---SAHQNHPLTRFAFLA---CVDFVYDESALEQLQELGLVPLLIKRLVELAQ 427

  Fly   388 DE----------------CDEVLTNVTGAISECVRFQSNREQLR--QAGGLPAMVSLLNSSHAPL 434
            .|                |.|::::...:........:.||.:.  |..|..:.:||.:...:..
Zfish   428 GEEPNTGKMDASLASSSPCSELMSSCFNSFDFSALEGNKREDVSKDQTAGSSSFLSLRSWLVSEG 492

  Fly   435 LENLAKGLKECAEDPD 450
            |.:....|.||...||
Zfish   493 LISSEGELTECPSGPD 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
guduNP_609111.1 armadillo repeat 105..134 CDD:293788 10/36 (28%)
armadillo repeat 144..180 CDD:293788 13/37 (35%)
Arm_3 214..557 CDD:330530 66/314 (21%)
armadillo repeat 245..275 CDD:293788 6/42 (14%)
armadillo repeat 286..318 CDD:293788 8/46 (17%)
armadillo repeat 328..362 CDD:293788 13/33 (39%)
armadillo repeat 411..447 CDD:293788 10/37 (27%)
armadillo repeat 453..484 CDD:293788
armadillo repeat 494..526 CDD:293788
ARM 614..652 CDD:214547
armadillo repeat 619..652 CDD:293788
armc5XP_021329768.1 armadillo repeat 98..129 CDD:293788 9/30 (30%)
armadillo repeat 136..170 CDD:293788 11/33 (33%)
armadillo repeat 177..232 CDD:293788 14/59 (24%)
armadillo repeat 238..273 CDD:293788 6/42 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.