Sequence 1: | NP_609111.1 | Gene: | gudu / 34014 | FlyBaseID: | FBgn0031905 | Length: | 669 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006256402.1 | Gene: | Rsph14 / 365552 | RGDID: | 1305601 | Length: | 341 | Species: | Rattus norvegicus |
Alignment Length: | 325 | Identity: | 69/325 - (21%) |
---|---|---|---|
Similarity: | 113/325 - (34%) | Gaps: | 65/325 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 208 LKTPRDQLSPDDLESLDMTRAGARALFTLADSKHNMEQMRKS---GIVPLMAQLLKS------CH 263
Fly 264 IDVVIPIMGT-----------------------------------VRKCSSEPKFQLAITTEGMI 293
Fly 294 PDIVSHLSSENTELKMEGSTAIYKCAFDGTTRDLVREAGGLEPLVTIIKDKNVRENKPLLRGATG 358
Fly 359 AIWMCAVTDANVKVLDQLRTVNHLVALLNDECDEVLTNVTGAISECVRFQSNREQLRQAGGLPAM 423
Fly 424 VSLLNSSHAPLLE---NLAKGLKECAEDPDSMRILEDLDAVRLIWSLL--KNPTTRVQAHAAYAI 483
Fly 484 483 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
gudu | NP_609111.1 | armadillo repeat | 105..134 | CDD:293788 | |
armadillo repeat | 144..180 | CDD:293788 | |||
Arm_3 | 214..557 | CDD:330530 | 68/319 (21%) | ||
armadillo repeat | 245..275 | CDD:293788 | 8/73 (11%) | ||
armadillo repeat | 286..318 | CDD:293788 | 7/31 (23%) | ||
armadillo repeat | 328..362 | CDD:293788 | 7/33 (21%) | ||
armadillo repeat | 411..447 | CDD:293788 | 8/38 (21%) | ||
armadillo repeat | 453..484 | CDD:293788 | 10/33 (30%) | ||
armadillo repeat | 494..526 | CDD:293788 | |||
ARM | 614..652 | CDD:214547 | |||
armadillo repeat | 619..652 | CDD:293788 | |||
Rsph14 | XP_006256402.1 | HEAT repeat | 27..55 | CDD:293787 | 9/32 (28%) |
HEAT repeat | 72..93 | CDD:293787 | 4/20 (20%) | ||
HEAT repeat | 109..137 | CDD:293787 | 0/27 (0%) | ||
ARM | 143..253 | CDD:237987 | 27/115 (23%) | ||
HEAT repeat | 151..175 | CDD:293787 | 4/23 (17%) | ||
armadillo repeat | 190..215 | CDD:293788 | 6/24 (25%) | ||
armadillo repeat | 222..257 | CDD:293788 | 11/34 (32%) | ||
ARM | 224..337 | CDD:237987 | 32/117 (27%) | ||
armadillo repeat | 263..295 | CDD:293788 | 7/33 (21%) | ||
HEAT repeat | 308..334 | CDD:293787 | 9/27 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0167 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |