DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gudu and arm

DIOPT Version :9

Sequence 1:NP_609111.1 Gene:gudu / 34014 FlyBaseID:FBgn0031905 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001259149.1 Gene:arm / 31151 FlyBaseID:FBgn0000117 Length:843 Species:Drosophila melanogaster


Alignment Length:613 Identity:128/613 - (20%)
Similarity:225/613 - (36%) Gaps:168/613 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 IPLIVDILNSSMKDLKTMAAETLANVCKVRLARKYVRTCGGIPKLVDLIDIKLSILKTPRDQLSP 217
            ||.::.:||...:.:.:.||..:..:.|...:|..:...   |::|..:...:|         :.
  Fly   161 IPELIKLLNDEDQVVVSQAAMMVHQLSKKEASRHAIMNS---PQMVAALVRAIS---------NS 213

  Fly   218 DDLESLDMTRAGARALFTLADSKHNMEQMRKSGIVPLMAQLLKSCHIDVVIPIMGTVRKCSSEPK 282
            :||||   |:|....|..|:..:..:..:.|||.:|.:.:||.|       |:         |..
  Fly   214 NDLES---TKAAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSS-------PV---------ESV 259

  Fly   283 FQLAITTEGMIPDIVSHLSSENTELKMEGSTAIYKCAFDGTTRDLVREAGGLEPLVTIIKDKNVR 347
            ...||||            ..|..|..:||    |.|        ||.||||:.:||:::..||:
  Fly   260 LFYAITT------------LHNLLLHQDGS----KMA--------VRLAGGLQKMVTLLQRNNVK 300

  Fly   348 ENKPLLRGATGAIWMCAVTDANVKVLDQLRTVNHLVALLNDECDEVL---------------TNV 397
                         ::..|||. :::|......:.|:.|.:...:|::               :.|
  Fly   301 -------------FLAIVTDC-LQILAYGNQESKLIILASGGPNELVRIMRSYDYEKLLWTTSRV 351

  Fly   398 TGAISECVRFQSNREQLRQAGGLPAMVSLLNSSHAPLLENLAKGLKECAEDPDSMRILE------ 456
            ...:|.|   .||:..:..|||:.|:...|.:....|::|....|:..::....:..||      
  Fly   352 LKVLSVC---SSNKPAIVDAGGMQALAMHLGNMSPRLVQNCLWTLRNLSDAATKVEGLEALLQSL 413

  Fly   457 -------DLDAVRLIWSLLKNPTTRVQAHAAY--------AICPCVRNANDSAELVRSLVGA--- 503
                   |::.|.....:|.|.|...|.:.|.        |:...:.||.|..|:....|.|   
  Fly   414 VQVLGSTDVNVVTCAAGILSNLTCNNQRNKATVCQVGGVDALVRTIINAGDREEITEPAVCALRH 478

  Fly   504 --------------------MELVVGLLKSKDIM-VLSAVCAAIATIAQDQTNLAILTDLKVIYK 547
                                :.::|.||...... ::.||...|..:|....|.|.|.:...|:.
  Fly   479 LTSRHVDSELAQNAVRLNYGLSVIVKLLHPPSRWPLIKAVIGLIRNLALCPANHAPLREHGAIHH 543

  Fly   548 LADLV----QTTD------------------DLLRMN--LAAAVAACACFG--NNTEELGRLRTV 586
            |..|:    |.|:                  |.:||.  :...|.|.....  ::...|.|.::|
  Fly   544 LVRLLMRAFQDTERQRSSIATTGSQQPSAYADGVRMEEIVEGTVGALHILARESHNRALIRQQSV 608

  Fly   587 TPI-VTYMTSDNPLVHRSTAMALEKLSMDPQNCITMHQSGVVPFLLECIGSTNKELQLAAAGCLR 650
            .|| |..:.::...:.|..|..|.:|:.|.:....:.|.|....|.:.:.|.|:.:...||..|.
  Fly   609 IPIFVRLLFNEIENIQRVAAGVLCELAADKEGAEIIEQEGATGPLTDLLHSRNEGVATYAAAVLF 673

  Fly   651 NIRE---------LALRAEEYLLKIDDD 669
            .:.|         |::.....||:.|::
  Fly   674 RMSEDKPQDYKKRLSIELTNSLLREDNN 701

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
guduNP_609111.1 armadillo repeat 105..134 CDD:293788
armadillo repeat 144..180 CDD:293788 6/26 (23%)
Arm_3 214..557 CDD:330530 88/424 (21%)
armadillo repeat 245..275 CDD:293788 8/29 (28%)
armadillo repeat 286..318 CDD:293788 8/31 (26%)
armadillo repeat 328..362 CDD:293788 10/33 (30%)
armadillo repeat 411..447 CDD:293788 8/35 (23%)
armadillo repeat 453..484 CDD:293788 10/51 (20%)
armadillo repeat 494..526 CDD:293788 8/55 (15%)
ARM 614..652 CDD:214547 9/37 (24%)
armadillo repeat 619..652 CDD:293788 8/32 (25%)
armNP_001259149.1 Adaptin_N <150..>314 CDD:331138 52/221 (24%)
armadillo repeat 161..186 CDD:293788 6/24 (25%)
armadillo repeat 193..231 CDD:293788 12/52 (23%)
armadillo repeat 238..270 CDD:293788 13/59 (22%)
armadillo repeat 278..314 CDD:293788 16/57 (28%)
armadillo repeat 320..355 CDD:293788 4/34 (12%)
Arm 361..398 CDD:278915 9/36 (25%)
armadillo repeat 362..397 CDD:293788 8/34 (24%)
armadillo repeat 410..435 CDD:293788 3/24 (13%)
Arm 439..481 CDD:278915 9/41 (22%)
armadillo repeat 443..481 CDD:293788 8/37 (22%)
armadillo repeat 490..525 CDD:293788 6/34 (18%)
Arm 597..636 CDD:278915 10/38 (26%)
armadillo repeat 600..636 CDD:293788 10/35 (29%)
armadillo repeat 641..675 CDD:293788 8/33 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464371
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2332
SonicParanoid 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.