Sequence 1: | NP_609111.1 | Gene: | gudu / 34014 | FlyBaseID: | FBgn0031905 | Length: | 669 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011528452.1 | Gene: | RSPH14 / 27156 | HGNCID: | 13437 | Length: | 402 | Species: | Homo sapiens |
Alignment Length: | 274 | Identity: | 58/274 - (21%) |
---|---|---|---|
Similarity: | 102/274 - (37%) | Gaps: | 76/274 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 194 IPKLVDLIDIKLSILKTPRDQLSPDDLESLDMTRAGARALFTLADSKHNMEQMRKS---GIVPLM 255
Fly 256 AQLLKS------------CHI--------------DVVIPI-----------MGTVRKCSSE--- 280
Fly 281 -PKFQLAITTEGMIPDIVSHLSSENTELKMEG---STAIYKCAFDGTTRDLVREAGGLEPLVTII 341
Fly 342 KDKNVRENKPLLRGATGAIWMCAVTDANVKVLDQLRTVNHLVALLNDECDEVLTNVTGAI--SEC 404
Fly 405 VRFQSNREQLRQAG 418 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
gudu | NP_609111.1 | armadillo repeat | 105..134 | CDD:293788 | |
armadillo repeat | 144..180 | CDD:293788 | |||
Arm_3 | 214..557 | CDD:330530 | 55/254 (22%) | ||
armadillo repeat | 245..275 | CDD:293788 | 10/69 (14%) | ||
armadillo repeat | 286..318 | CDD:293788 | 8/34 (24%) | ||
armadillo repeat | 328..362 | CDD:293788 | 9/33 (27%) | ||
armadillo repeat | 411..447 | CDD:293788 | 3/8 (38%) | ||
armadillo repeat | 453..484 | CDD:293788 | |||
armadillo repeat | 494..526 | CDD:293788 | |||
ARM | 614..652 | CDD:214547 | |||
armadillo repeat | 619..652 | CDD:293788 | |||
RSPH14 | XP_011528452.1 | ARM | <18..91 | CDD:237987 | 19/82 (23%) |
HEAT repeat | 27..55 | CDD:293787 | 12/46 (26%) | ||
HEAT_2 | 28..131 | CDD:290374 | 24/122 (20%) | ||
HEAT repeat | 65..97 | CDD:293787 | 6/31 (19%) | ||
HEAT repeat | 107..134 | CDD:293787 | 4/26 (15%) | ||
ARM | 188..>255 | CDD:237987 | 16/67 (24%) | ||
HEAT_2 | 194..>255 | CDD:290374 | 14/60 (23%) | ||
armadillo repeat | 224..256 | CDD:293788 | 10/31 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0167 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |