DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gudu and RSPH14

DIOPT Version :9

Sequence 1:NP_609111.1 Gene:gudu / 34014 FlyBaseID:FBgn0031905 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_011528452.1 Gene:RSPH14 / 27156 HGNCID:13437 Length:402 Species:Homo sapiens


Alignment Length:274 Identity:58/274 - (21%)
Similarity:102/274 - (37%) Gaps:76/274 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 IPKLVDLIDIKLSILKTPRDQLSPDDLESLDMTRAGARALFTLADSKHNMEQMRKS---GIVPLM 255
            :|||              :::|..:||:    ||  .:||..|.|..|:.|.:.|:   |.:..:
Human    28 LPKL--------------KEELQSEDLQ----TR--QKALMALCDLMHDPECIYKAMNIGCMENL 72

  Fly   256 AQLLKS------------CHI--------------DVVIPI-----------MGTVRKCSSE--- 280
            ..|||.            .||              |:|:.:           .|.:.|...:   
Human    73 KALLKDSNSMVRIKTTEVLHITASHSVGRYAFLEHDIVLALSFLLNDPSPVCRGNLYKAYMQLVQ 137

  Fly   281 -PKFQLAITTEGMIPDIVSHLSSENTELKMEG---STAIYKCAFDGTTRDLVREAGGLEPLVTII 341
             |:....|.::|:|..:|..|..|..|.:.:.   .|.:.....|.|      ||.| ..:|.::
Human   138 VPRGAQEIISKGLISSLVWKLQVEVEEEEFQEFILDTLVLCLQEDAT------EALG-SNVVLVL 195

  Fly   342 KDKNVRENKPLLRGATGAIWMCAVTDANVKVLDQLRTVNHLVALLNDECDEVLTNVTGAI--SEC 404
            |.|.:..|:.:...|..|:...:::....|.:.....:..||.||.|..:.|.:|..||:  :..
Human   196 KQKLLSANQNIRSKAARALLNVSISREGKKQVCHFDVIPILVHLLKDPVEHVKSNAAGALMFATV 260

  Fly   405 VRFQSNREQLRQAG 418
            :..:.....:.|||
Human   261 ITEEMESHYVAQAG 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
guduNP_609111.1 armadillo repeat 105..134 CDD:293788
armadillo repeat 144..180 CDD:293788
Arm_3 214..557 CDD:330530 55/254 (22%)
armadillo repeat 245..275 CDD:293788 10/69 (14%)
armadillo repeat 286..318 CDD:293788 8/34 (24%)
armadillo repeat 328..362 CDD:293788 9/33 (27%)
armadillo repeat 411..447 CDD:293788 3/8 (38%)
armadillo repeat 453..484 CDD:293788
armadillo repeat 494..526 CDD:293788
ARM 614..652 CDD:214547
armadillo repeat 619..652 CDD:293788
RSPH14XP_011528452.1 ARM <18..91 CDD:237987 19/82 (23%)
HEAT repeat 27..55 CDD:293787 12/46 (26%)
HEAT_2 28..131 CDD:290374 24/122 (20%)
HEAT repeat 65..97 CDD:293787 6/31 (19%)
HEAT repeat 107..134 CDD:293787 4/26 (15%)
ARM 188..>255 CDD:237987 16/67 (24%)
HEAT_2 194..>255 CDD:290374 14/60 (23%)
armadillo repeat 224..256 CDD:293788 10/31 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0167
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.