DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gudu and RSPH14

DIOPT Version :10

Sequence 1:NP_609111.1 Gene:gudu / 34014 FlyBaseID:FBgn0031905 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_011528452.1 Gene:RSPH14 / 27156 HGNCID:13437 Length:402 Species:Homo sapiens


Alignment Length:274 Identity:58/274 - (21%)
Similarity:102/274 - (37%) Gaps:76/274 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 IPKLVDLIDIKLSILKTPRDQLSPDDLESLDMTRAGARALFTLADSKHNMEQMRKS---GIVPLM 255
            :|||              :::|..:||:    ||  .:||..|.|..|:.|.:.|:   |.:..:
Human    28 LPKL--------------KEELQSEDLQ----TR--QKALMALCDLMHDPECIYKAMNIGCMENL 72

  Fly   256 AQLLKS------------CHI--------------DVVIPI-----------MGTVRKCSSE--- 280
            ..|||.            .||              |:|:.:           .|.:.|...:   
Human    73 KALLKDSNSMVRIKTTEVLHITASHSVGRYAFLEHDIVLALSFLLNDPSPVCRGNLYKAYMQLVQ 137

  Fly   281 -PKFQLAITTEGMIPDIVSHLSSENTELKMEG---STAIYKCAFDGTTRDLVREAGGLEPLVTII 341
             |:....|.::|:|..:|..|..|..|.:.:.   .|.:.....|.|      ||.| ..:|.::
Human   138 VPRGAQEIISKGLISSLVWKLQVEVEEEEFQEFILDTLVLCLQEDAT------EALG-SNVVLVL 195

  Fly   342 KDKNVRENKPLLRGATGAIWMCAVTDANVKVLDQLRTVNHLVALLNDECDEVLTNVTGAI--SEC 404
            |.|.:..|:.:...|..|:...:::....|.:.....:..||.||.|..:.|.:|..||:  :..
Human   196 KQKLLSANQNIRSKAARALLNVSISREGKKQVCHFDVIPILVHLLKDPVEHVKSNAAGALMFATV 260

  Fly   405 VRFQSNREQLRQAG 418
            :..:.....:.|||
Human   261 ITEEMESHYVAQAG 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
guduNP_609111.1 armadillo repeat 105..134 CDD:293788
armadillo repeat 144..180 CDD:293788
VRR_NUC <172..232 CDD:451466 8/37 (22%)
SRP1 214..557 CDD:227396 55/254 (22%)
armadillo repeat 245..275 CDD:293788 10/69 (14%)
armadillo repeat 286..318 CDD:293788 8/34 (24%)
armadillo repeat 328..362 CDD:293788 9/33 (27%)
armadillo repeat 411..447 CDD:293788 3/8 (38%)
armadillo repeat 453..484 CDD:293788
armadillo repeat 494..526 CDD:293788
Arm 614..652 CDD:425727
armadillo repeat 619..652 CDD:293788
RSPH14XP_011528452.1 HEAT repeat 27..55 CDD:293787 12/46 (26%)
PDS5 <28..>120 CDD:466319 23/111 (21%)
HEAT repeat 65..97 CDD:293787 6/31 (19%)
HEAT repeat 107..134 CDD:293787 4/26 (15%)
Arm 220..255 CDD:425727 9/34 (26%)
armadillo repeat 224..256 CDD:293788 10/31 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.