DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gudu and CTNND2

DIOPT Version :9

Sequence 1:NP_609111.1 Gene:gudu / 34014 FlyBaseID:FBgn0031905 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_005248308.1 Gene:CTNND2 / 1501 HGNCID:2516 Length:1250 Species:Homo sapiens


Alignment Length:489 Identity:101/489 - (20%)
Similarity:182/489 - (37%) Gaps:166/489 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 IPLIVDILNSSMKDLKTMAAETLANVC----KVRLARKYVRTCGGIPKLVDLIDIKLSILKTPRD 213
            :|.::.:|......:::.||..|.::|    |::..   :|..|||..||||:|.:::       
Human   552 LPEVIQMLQHQFPSVQSNAAAYLQHLCFGDNKIKAE---IRRQGGIQLLVDLLDHRMT------- 606

  Fly   214 QLSPDDLESLDMTRAGARALFTLADSKHNMEQ---MRKSGIVPLMAQLL-KSCHIDV---VIPIM 271
                      ::.|:...||..|...|.|.:.   ::..|.:|.:.:|| |:..:::   |..::
Human   607 ----------EVHRSACGALRNLVYGKANDDNKIALKNCGGIPALVRLLRKTTDLEIRELVTGVL 661

  Fly   272 GTVRKCSS--EPKFQ--LAITTEGMIPDIVSHLSSENTELKMEGSTAIYKCAFDGTTRDLVREAG 332
            ..:..|.:  .|..|  ||:.|..:   |:.|...||:.|:.:....::       :..::|.|.
Human   662 WNLSSCDALKMPIIQDALAVLTNAV---IIPHSGWENSPLQDDRKIQLH-------SSQVLRNAT 716

  Fly   333 GLEPLVTIIKDKNV----RENKPLLRGATGAIWMCAVTDANVKVLDQL--------RTVNHLVAL 385
            |..        :||    .|.:..:|...|      :|||.:.|:...        :||.:.|.:
Human   717 GCL--------RNVSSAGEEARRRMRECDG------LTDALLYVIQSALGSSEIDSKTVENCVCI 767

  Fly   386 L------------------NDECDEVL--------TNVTGAISECVRFQSNREQLRQAGGLPAMV 424
            |                  .||.|.:|        ...:|...:..:.:.:::|....|.||   
Human   768 LRNLSYRLAAETSQGQHMGTDELDGLLCGEANGKDAESSGCWGKKKKKKKSQDQWDGVGPLP--- 829

  Fly   425 SLLNSSHAPLLENLAKGLKECAEDPDSMRILEDLDAVRLIWSLL---KNPTT------RVQ---- 476
                               :|||.|..:::|.....|:...:||   .||.|      .:|    
Human   830 -------------------DCAEPPKGIQMLWHPSIVKPYLTLLSECSNPDTLEGAAGALQNLAA 875

  Fly   477 ----------AHAAYAI------CPC-------VRNANDSAELVRSLVGAMELVVGLLKSKDIMV 518
                      |..|||:      .||       :|.|      ||...| :.::|.||:..:..|
Human   876 GSWKGWAEDVAGMAYALRSLPEGAPCLPQWSVYIRAA------VRKEKG-LPILVELLRIDNDRV 933

  Fly   519 LSAVCAAIATIAQDQTNLAILTDLKVIYKLADLV 552
            :.||..|:..:|.|..|..::..    |.:.|||
Human   934 VCAVATALRNMALDVRNKELIGK----YAMRDLV 963

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
guduNP_609111.1 armadillo repeat 105..134 CDD:293788
armadillo repeat 144..180 CDD:293788 6/30 (20%)
Arm_3 214..557 CDD:330530 85/424 (20%)
armadillo repeat 245..275 CDD:293788 6/36 (17%)
armadillo repeat 286..318 CDD:293788 7/31 (23%)
armadillo repeat 328..362 CDD:293788 8/37 (22%)
armadillo repeat 411..447 CDD:293788 5/35 (14%)
armadillo repeat 453..484 CDD:293788 12/59 (20%)
armadillo repeat 494..526 CDD:293788 9/31 (29%)
ARM 614..652 CDD:214547
armadillo repeat 619..652 CDD:293788
CTNND2XP_005248308.1 ARM 544..666 CDD:237987 28/133 (21%)
armadillo repeat 552..577 CDD:293788 5/24 (21%)
armadillo repeat 585..621 CDD:293788 13/55 (24%)
armadillo repeat 629..664 CDD:293788 6/34 (18%)
armadillo repeat 671..722 CDD:293788 13/68 (19%)
Arm 834..875 CDD:278915 9/40 (23%)
armadillo repeat 838..875 CDD:293788 8/36 (22%)
armadillo repeat 910..944 CDD:293788 12/40 (30%)
ARM 911..1043 CDD:237987 18/64 (28%)
armadillo repeat 951..997 CDD:293788 4/17 (24%)
armadillo repeat 1003..1038 CDD:293788
CAF20 <1054..1113 CDD:293657
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2332
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.