DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gudu and ankar

DIOPT Version :9

Sequence 1:NP_609111.1 Gene:gudu / 34014 FlyBaseID:FBgn0031905 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_031749763.1 Gene:ankar / 100496722 XenbaseID:XB-GENE-1010351 Length:1400 Species:Xenopus tropicalis


Alignment Length:601 Identity:121/601 - (20%)
Similarity:241/601 - (40%) Gaps:142/601 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 WKEVARAAEIPADYYNIQKLVKYIKAGNQTATIVSLCCLKDYDLSTQINQFAISDIGGLDVLVNI 118
            |:::.:|..||:       ||:.:.:.......::|..|.:...:..::: |:...|.:.|||::
 Frog   754 WEDIYKAGTIPS-------LVELLHSDQVPLKCLALGILSNISNNNPVSR-ALVKSGAIQVLVHL 810

  Fly   119 LECS----DTKCCLGALKVLSDITLNIDIRKTIV-DLDGIPLIVDILNSSMKDLKTMAAETLANV 178
            |...    .::|.:    :||||. .||..:.:: ::|||..:|.:|....:|:...|...:..:
 Frog   811 LHSRQPELQSRCSV----LLSDIA-QIDSNQNVIAEMDGISPLVHLLYEKYEDVLVNAVNCIRVL 870

  Fly   179 C-KVRLARKYVRTCGGIPKLVDLIDIKLSILKTPRDQLSPDDLESLDMTRAGARALFTLA-DSKH 241
            | |....:|.||..|.||.||:.:..|..||                 ..|....:..|| |:|.
 Frog   871 CIKNTANQKAVRDLGAIPSLVEFLTAKSDIL-----------------VSAATDVIAELARDNKA 918

  Fly   242 NMEQMRKSGIVPLMAQLLKSCHIDVVIPIMGTVRK-CSSEPKFQLAITTEGMIPDIVSHLSSENT 305
            ..:.:.|.|::..:..:|:..:|::.:....|:.. |...|..|....|:.:...|...|.....
 Frog   919 IQDAVTKEGVIESLISILRVRNINIQVKAAMTIEALCDHNPAVQKEFLTKSVTKHISKLLKVFQL 983

  Fly   306 ELKMEGSTAI-------------------YKCAFDG--TTRDLVREAGGLEPLVTIIKDKNVREN 349
            |::.:|||.:                   |||..|.  :..|.::..|| |.::.:.||..    
 Frog   984 EVREQGSTTLWALAGQTRKQQKAMAEYIGYKCIIDMLLSPSDKMQYIGG-EAIIALCKDSR---- 1043

  Fly   350 KPLLRGATGAIWMCAVTDAN-----VKVLDQLRTVN-HLVALLNDECDEVLTNVTGAISECVRFQ 408
                      .:.|.:.:.|     |::|...:..| .|:.::         ...|.:...|.|.
 Frog  1044 ----------HYQCQICEGNGIGPLVRLLRSPKVANGTLIRII---------KALGIMCIGVAFI 1089

  Fly   409 SN---REQLRQAGGLPAMVSLL---NSSH--APLLENLAKGLKECAEDPDSMRILEDL---DAVR 462
            :|   :|::.:...:|.::.||   ||.|  |.:...||..:...:...||::.:||:   |.:.
 Frog  1090 NNPVAQEKIVEENAIPTLLHLLKTQNSLHVKAEVACTLACIVLRNSNLQDSLKEMEDVKYSDILD 1154

  Fly   463 LIW--------------------------SLLKNPTTRV--------------QAHAAYAICPCV 487
            |::                          ::|:|...::              :|.||:.|....
 Frog  1155 LLYASDKAICLRAGYALSLFAYSSTMQQFNILENGGIKISIYEPFLQSDIEPERALAAFQIVVLA 1219

  Fly   488 RNANDSAELVRSLVGAMELVVGLLKSKDIMVLSAVCAAIATIAQDQTNL-AILTDLKVIYKLADL 551
            :..:|..::.....| :.::..||:||:...|......:||:|..:|.: ..:|.|..:..|.:.
 Frog  1220 KVISDMDQITLCTKG-VTVLTELLQSKNPTTLVLTGELLATLAHIRTGIPEAITTLGTVKCLCNH 1283

  Fly   552 VQTTDDLLRMNLAAAV 567
            :.:.|:.:|:..|.|:
 Frog  1284 LYSPDEEVRIACANAL 1299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
guduNP_609111.1 armadillo repeat 105..134 CDD:293788 7/32 (22%)
armadillo repeat 144..180 CDD:293788 8/37 (22%)
Arm_3 214..557 CDD:330530 76/423 (18%)
armadillo repeat 245..275 CDD:293788 5/29 (17%)
armadillo repeat 286..318 CDD:293788 8/50 (16%)
armadillo repeat 328..362 CDD:293788 5/33 (15%)
armadillo repeat 411..447 CDD:293788 10/40 (25%)
armadillo repeat 453..484 CDD:293788 9/73 (12%)
armadillo repeat 494..526 CDD:293788 6/31 (19%)
ARM 614..652 CDD:214547
armadillo repeat 619..652 CDD:293788
ankarXP_031749763.1 ANKYR <530..641 CDD:223738
ANK repeat 537..586 CDD:293786
Ank_2 593..688 CDD:403870
ANK repeat 621..655 CDD:293786
ANK repeat 657..688 CDD:293786
PLN03200 <722..>1011 CDD:215629 61/286 (21%)
armadillo repeat 722..746 CDD:293788
armadillo repeat 756..788 CDD:293788 7/38 (18%)
armadillo repeat 796..831 CDD:293788 11/40 (28%)
armadillo repeat 836..870 CDD:293788 7/33 (21%)
armadillo repeat 878..912 CDD:293788 12/50 (24%)
armadillo repeat 920..954 CDD:293788 5/33 (15%)
armadillo repeat 962..996 CDD:293788 8/33 (24%)
armadillo repeat 1014..1038 CDD:293788 7/24 (29%)
armadillo repeat 1046..1084 CDD:293788 7/46 (15%)
armadillo repeat 1095..1130 CDD:293788 10/34 (29%)
armadillo repeat 1185..1218 CDD:293788 6/32 (19%)
armadillo repeat 1235..1260 CDD:293788 6/24 (25%)
armadillo repeat 1268..1304 CDD:293788 7/32 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.