DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5149 and AT4G34070

DIOPT Version :9

Sequence 1:NP_609110.1 Gene:CG5149 / 34013 FlyBaseID:FBgn0031904 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_195133.3 Gene:AT4G34070 / 829553 AraportID:AT4G34070 Length:313 Species:Arabidopsis thaliana


Alignment Length:318 Identity:70/318 - (22%)
Similarity:113/318 - (35%) Gaps:94/318 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RETDNLYNSEELRMLESAYK----NASG------GALEKLTQDRLVETWSQTIE-RSLAESTAQY 61
            |.|:....:.|||..::..|    |:|.      .|....||.:|.:..|.... .|.::|..||
plant    27 RRTETTKPAGELRGEKNPAKKGNSNSSSVDHCFTSASRAFTQKKLADLKSLFFSLASKSQSNDQY 91

  Fly    62 LFTPTKPGQQCVNLQLKKFGEPYYIM----------------------ERGTIDQKMQMLLGSME 104
            :..|.  .|:...|. ...||..:.|                      |:||.|:..:.:..:::
plant    92 VSYPV--FQEYFGLS-GSLGERIFDMVTQHRKDDKMTFEDLVIAKATYEKGTDDEIAEFIYQTLD 153

  Fly   105 RSGNDTFNSKQLEQYIYSVIKSYVHLEST-AKNSGIKEWHDLGFNTTERSAATFAKGLMRNLGKE 168
            .:||.......||.::..::||....||: |::|..||..|...:     ||||:|.     ...
plant   154 VNGNGVLRRSDLESFLVVILKSVFSTESSDAESSDYKEMVDALLD-----AATFSKS-----DDG 208

  Fly   169 LEHTMPNDALERWLHVTPQFLQIWREVFSQLYCRHGGSKRNIIKEMEIPILPALCDAPQNSHYRP 233
            .|..|..:....|..:.|..                   |..:..:.||..|.          ||
plant   209 SEKGMSFEDFRSWCPLVPTI-------------------RKFLGSLLIPPGPV----------RP 244

  Fly   234 IIELPHVLY------------------INAQLPREHRHKWRFLFSSKINGESFSTMLG 273
            ..::|.:||                  |...||.....:|:.|:.|.::|:||:|.||
plant   245 GYQVPDLLYEDSVSSDRLLLKKEYAWHIGGALPHHELVEWKLLYRSSLHGQSFNTFLG 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5149NP_609110.1 DMP12 11..>67 CDD:293384 16/66 (24%)
TLDc 232..400 CDD:214733 17/60 (28%)
AT4G34070NP_195133.3 EF-hand_7 145..222 CDD:290234 20/86 (23%)
TLD 261..>312 CDD:295191 12/42 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2557
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 135 1.000 Inparanoid score I1833
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003986
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4376
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.820

Return to query results.
Submit another query.