DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5149 and AT4G22740

DIOPT Version :10

Sequence 1:NP_609110.1 Gene:CG5149 / 34013 FlyBaseID:FBgn0031904 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_567666.1 Gene:AT4G22740 / 828370 AraportID:AT4G22740 Length:356 Species:Arabidopsis thaliana


Alignment Length:106 Identity:23/106 - (21%)
Similarity:39/106 - (36%) Gaps:28/106 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NLYNSEELRMLESAYKNASGGALEKLTQDRLVETWSQTI-----------ERSLAESTAQYLFTP 65
            |....|...|:.....|.......||..|..|:| :||:           |:|.:.:..:.:..|
plant   244 NTATREAAHMISRGLHNKGHTVARKLNSDGRVDT-TQTLHNLNEDELAGFEQSWSGNARRQMQLP 307

  Fly    66 TKPGQQCVNLQLKKFGEPYYIMERGTIDQKMQMLLGSMERS 106
            ::.|         .||.       |.::::..|||.|.:.|
plant   308 SRSG---------SFGS-------GLVNREQPMLLPSTDPS 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5149NP_609110.1 TLDc 232..400 CDD:214733
AT4G22740NP_567666.1 Mlf1IP 142..299 CDD:463022 13/55 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.