DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5149 and AT2G45380

DIOPT Version :10

Sequence 1:NP_609110.1 Gene:CG5149 / 34013 FlyBaseID:FBgn0031904 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_850433.2 Gene:AT2G45380 / 819145 AraportID:AT2G45380 Length:494 Species:Arabidopsis thaliana


Alignment Length:66 Identity:19/66 - (28%)
Similarity:26/66 - (39%) Gaps:17/66 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNASGKRETDNLYN--SEELRMLESAYK--------------NASGG-ALEKLTQDRLVETWSQ 48
            :.::.|...|..|:|  .:||...|.|:|              |:.|| .|..|.|.|.....||
plant   411 LNSSGGVESTQTLHNLDEDELSGFEEAWKGNSSLGKHEFTGSDNSFGGWVLPSLDQIRRQTDQSQ 475

  Fly    49 T 49
            |
plant   476 T 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5149NP_609110.1 TLDc 232..400 CDD:214733
AT2G45380NP_850433.2 Mlf1IP <352..441 CDD:463022 9/29 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.