DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5149 and mtd

DIOPT Version :9

Sequence 1:NP_609110.1 Gene:CG5149 / 34013 FlyBaseID:FBgn0031904 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001246928.1 Gene:mtd / 45467 FlyBaseID:FBgn0013576 Length:1344 Species:Drosophila melanogaster


Alignment Length:288 Identity:69/288 - (23%)
Similarity:113/288 - (39%) Gaps:84/288 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 YSVIKSYVHLESTAKNSGIKEWHD--------LGFNTTE-RSAATFAKGLMRNLGKELEHTMPND 176
            |.:||:..|..|          ||        |..:|.| |..:.||.|..     :|:..:| |
  Fly  1129 YKIIKTASHAAS----------HDLEMLGGEVLSMSTDEYRKTSLFATGSF-----DLDFPIP-D 1177

  Fly   177 ALERWLHVTPQFLQIWREVFSQLYCRHGGSKRNIIKEMEIPILPALCDAPQNSHYRPIIELPHVL 241
            .:.:        .:|..|...:..|.|               |||                    
  Fly  1178 LIGK--------TEILTEEHREKLCSH---------------LPA-------------------- 1199

  Fly   242 YINAQLPREHRHKWRFLFSSKINGESFSTMLGKVLD-KGPTLFFIEDEDQYIFGGYASETWSVKP 305
                   |...:.|..:||:..:|.:.:::..|:.. :.|.|..|||.:..:||...|.:..|..
  Fly  1200 -------RAEGYSWSLIFSTSQHGFALNSLYRKMARLESPVLIVIEDTEHNVFGALTSCSLHVSD 1257

  Fly   306 QFGGDDSSLLYTLSPAMRCFSATTYNNHYQYLNLNQQTMPNGLGMGGQFDFWGLWIDCSFGDGQS 370
            .|.|...||||..:|:.:.|..|..|.:  ::..|.:::..|.| .|:|   |||:|.....|:|
  Fly  1258 HFYGTGESLLYKFNPSFKVFHWTGENMY--FIKGNMESLSIGAG-DGRF---GLWLDGDLNQGRS 1316

  Fly   371 VESCTTYRDYVQLSKRKQFKIRNMEVWA 398
             :.|:||.: ..|:.::.|.|:.:|.||
  Fly  1317 -QQCSTYGN-EPLAPQEDFVIKTLECWA 1342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5149NP_609110.1 DMP12 11..>67 CDD:293384
TLDc 232..400 CDD:214733 45/168 (27%)
mtdNP_001246928.1 LysM 271..371 CDD:224306
LysM 329..371 CDD:279777
TLDc 1182..1344 CDD:214733 52/211 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439812
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23354
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.