DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5149 and Tldc2

DIOPT Version :9

Sequence 1:NP_609110.1 Gene:CG5149 / 34013 FlyBaseID:FBgn0031904 Length:448 Species:Drosophila melanogaster
Sequence 2:XP_006499899.1 Gene:Tldc2 / 383766 MGIID:2686178 Length:261 Species:Mus musculus


Alignment Length:188 Identity:56/188 - (29%)
Similarity:91/188 - (48%) Gaps:16/188 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 PILPALCDAPQNSHYRPIIELPHVLYINAQL-PREHRHKWRFLFSSKINGES----FSTMLGKVL 276
            |:.|.|.:|.|......|.:|...|.::..| ||...|.|..:|.:..:|.|    :..|.|   
Mouse    84 PVEPQLTEASQVLGASEIKQLQLHLQLSLHLPPRVTGHPWSLVFCTSRDGFSLRRLYRQMEG--- 145

  Fly   277 DKGPTLFFIEDEDQYIFGGYASETWSVKPQFGGDDSSLLYTLSPAMRCFSATTYNNHYQYLNLNQ 341
            ..||.|..:.|:|..:||.::|....:...|.|...:.|::.||.::.|..|.:|:.:...:|:.
Mouse   146 HSGPVLLLLRDQDGQMFGAFSSSAIRLSKGFYGTGETFLFSFSPQLKVFKWTGHNSFFVKGDLDS 210

  Fly   342 QTMPNGLGMGGQFDFWGLWIDCSFGDGQSVESCTTYRDYVQLSKRKQFKIRNMEVWAV 399
            ..|.:|   .|||   |||:|.....|.|. .|.|:.:.| |::|:||.|:.:|.|.:
Mouse   211 LMMGSG---SGQF---GLWLDGDLYHGGSY-PCATFNNEV-LARREQFCIKELEAWVL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5149NP_609110.1 DMP12 11..>67 CDD:293384
TLDc 232..400 CDD:214733 51/173 (29%)
Tldc2XP_006499899.1 TLDc 115..261 CDD:214733 47/157 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.