DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaC and AT5G14720

DIOPT Version :9

Sequence 1:NP_523503.2 Gene:ninaC / 34012 FlyBaseID:FBgn0002938 Length:1501 Species:Drosophila melanogaster
Sequence 2:NP_001330554.1 Gene:AT5G14720 / 831324 AraportID:AT5G14720 Length:674 Species:Arabidopsis thaliana


Alignment Length:273 Identity:89/273 - (32%)
Similarity:148/273 - (54%) Gaps:19/273 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FEIYEEIAQGVNAKVFRAKELDNDRIVALKIQHYDE--EHQVSIEEEYRTLRDYCDHPNLPEFYG 78
            :::||||..||:|.|.||..:..:.:||:|:...::  .....|..|.:|: ...:|||:.:.:.
plant    16 YKLYEEIGDGVSATVHRALCIPLNVVVAIKVLDLEKCNNDLDGIRREVQTM-SLINHPNVLQAHC 79

  Fly    79 VYKLSKPNGPDEIWFVMEYCAGGTAVDMVNKLLKLDRRMREEHIAYIIRETCRAAIELNRNHVLH 143
            .:...     .::|.||.|.|||:.:.::..  .......|..||.::|||.:|.:.|:.:..:|
plant    80 SFTTG-----HQLWVVMPYMAGGSCLHIIKS--SYPDGFEEPVIATLLRETLKALVYLHAHGHIH 137

  Fly   144 RDIRGDNILLTKNGRVKLCDFGLSRQVDSTLGK---RGTCIGSPCWMAPEVVSAMESREPDITVR 205
            ||::..||||..||.|||.|||:|..:..|..:   |.|.:|:||||||||:..:...:    .:
plant   138 RDVKAGNILLDSNGAVKLADFGVSACMFDTGDRQRSRNTFVGTPCWMAPEVMQQLHGYD----FK 198

  Fly   206 ADVWALGITTIELADGKPPFADMHPTRAMFQIIRNPPPTL--MRPTNWSQQINDFISESLEKNAE 268
            ||||:.|||.:|||.|..||:...|.:.:...::|.||.|  .|...:|:...:.:...|.|:.:
plant   199 ADVWSFGITALELAHGHAPFSKYPPMKVLLMTLQNAPPGLDYERDKRFSKAFKEMVGTCLVKDPK 263

  Fly   269 NRPMMVEMVEHPF 281
            .||...::::|||
plant   264 KRPTSEKLLKHPF 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaCNP_523503.2 STKc_myosinIII_N_like 9..282 CDD:270785 89/273 (33%)
S_TKc 16..282 CDD:214567 89/273 (33%)
MYSc 327..1034 CDD:214580
MYSc_Myo21 346..1022 CDD:276848
AT5G14720NP_001330554.1 STKc_OSR1_SPAK 14..277 CDD:270787 89/273 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.