DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaC and PLEKHH3

DIOPT Version :9

Sequence 1:NP_523503.2 Gene:ninaC / 34012 FlyBaseID:FBgn0002938 Length:1501 Species:Drosophila melanogaster
Sequence 2:XP_016880602.1 Gene:PLEKHH3 / 79990 HGNCID:26105 Length:882 Species:Homo sapiens


Alignment Length:208 Identity:45/208 - (21%)
Similarity:72/208 - (34%) Gaps:54/208 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1310 GVHRSGSRRNSLKGYAAP-PPP--PPPMPSSNYYRNNPNQQQRNYQQRSSYPPSDPVRELQNMAR 1371
            |..|.| ||::....|.| |.|  |.|:||.:...:.....:..:..|:...||.|..:::.   
Human    17 GALRQG-RRHAWPDLALPLPSPLGPRPIPSPSASASAEECGEAGWAARTPGSPSAPSSQVRR--- 77

  Fly  1372 NEGDNSEDPPFNFKAMLRKTNYPR-GSETNTYDFNNRRGSDSGDQHTFQPP-----KLRSTGRRY 1430
               .::..|.  .:...|..::|| |..:.......|||.....|:....|     |||.     
Human    78 ---PDARAPA--AETWTRGRSHPRIGGGSVEEGKMRRRGCLGAWQNELTSPVSKMGKLRP----- 132

  Fly  1431 QDDEGYNSSSGNYGVSRKFGQQQRAP-------TLRQSPASVGRSFEDSNARSFEEAGSYVEE-- 1486
                         |..::..|....|       .:|..|.|       :..:|:||..|.:.|  
Human   133 -------------GDGKRLAQGSTGPLEVTLTQPVRSGPVS-------NRLQSWEETWSLIPEKG 177

  Fly  1487 --EIAPGITLSGY 1497
              |..|.|.:.|:
Human   178 LPEDDPDIVVKGW 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaCNP_523503.2 STKc_myosinIII_N_like 9..282 CDD:270785
S_TKc 16..282 CDD:214567
MYSc 327..1034 CDD:214580
MYSc_Myo21 346..1022 CDD:276848
PLEKHH3XP_016880602.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4229
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.