DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaC and Tnik

DIOPT Version :9

Sequence 1:NP_523503.2 Gene:ninaC / 34012 FlyBaseID:FBgn0002938 Length:1501 Species:Drosophila melanogaster
Sequence 2:XP_006535580.1 Gene:Tnik / 665113 MGIID:1916264 Length:1374 Species:Mus musculus


Alignment Length:405 Identity:136/405 - (33%)
Similarity:212/405 - (52%) Gaps:52/405 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LPDPTDKFEIYEEIAQGVNAKVFRAKELDNDRIVALKIQHYDEEHQVSIEEEYRTLRDYCDHPNL 73
            |.||...||:.|.:..|...:|::.:.:...::.|:|:.....:.:..|::|...|:.|..|.|:
Mouse    18 LRDPAGIFELVELVGNGTYGQVYKGRHVKTGQLAAIKVMDVTGDEEEEIKQEINMLKKYSHHRNI 82

  Fly    74 PEFYGVY-KLSKPNGPDEIWFVMEYCAGGTAVDMVNKLLKLDRRMREEHIAYIIRETCRAAIELN 137
            ..:||.: |.:.|...|::|.|||:|..|:..|::..  .....::||.||||.||..|....|:
Mouse    83 ATYYGAFIKKNPPGMDDQLWLVMEFCGAGSVTDLIKN--TKGNTLKEEWIAYICREILRGLSHLH 145

  Fly   138 RNHVLHRDIRGDNILLTKNGRVKLCDFGLSRQVDSTLGKRGTCIGSPCWMAPEVVSAMESREPDI 202
            ::.|:||||:|.|:|||:|..|||.|||:|.|:|.|:|:|.|.||:|.||||||::..|:.:...
Mouse   146 QHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATY 210

  Fly   203 TVRADVWALGITTIELADGKPPFADMHPTRAMFQIIRNPPPTLMRPTNWSQQINDFISESLEKNA 267
            ..::|:|:||||.||:|:|.||..||||.||:|.|.|||.|.| :...||::...||...|.||.
Mouse   211 DFKSDLWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPAPRL-KSKKWSKKFQSFIESCLVKNH 274

  Fly   268 ENRPMMVEMVEHPFLTELIENEDEMRSDIAEMLELSRDVKTLYKEPELFVDRGYVKRFDEKPEKM 332
            ..||...::::|||:.:. .||.::|..:.:                 .:||...|| .||.|..
Mouse   275 SQRPATEQLMKHPFIRDQ-PNERQVRIQLKD-----------------HIDRTKKKR-GEKDETE 320

  Fly   333 YPEDLAALENPVDEN-------IIESLRHRILMGESYSFIGDILLSLNSNE-----IKQEFPQEF 385
            |  :.:..|...:||       |:.      |.|||......:.|.|.:.|     .:|:..|: 
Mouse   321 Y--EYSGSEEEEEENDSGEPSSILN------LPGESTLRRDFLRLQLANKERSEALRRQQLEQQ- 376

  Fly   386 HAKYRFKSRSENQPH 400
                    :.||:.|
Mouse   377 --------QRENEEH 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaCNP_523503.2 STKc_myosinIII_N_like 9..282 CDD:270785 108/273 (40%)
S_TKc 16..282 CDD:214567 105/266 (39%)
MYSc 327..1034 CDD:214580 20/86 (23%)
MYSc_Myo21 346..1022 CDD:276848 15/67 (22%)
TnikXP_006535580.1 STKc_TNIK 18..313 CDD:270807 114/315 (36%)
CNH 1045..1337 CDD:214481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.