DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaC and msn

DIOPT Version :9

Sequence 1:NP_523503.2 Gene:ninaC / 34012 FlyBaseID:FBgn0002938 Length:1501 Species:Drosophila melanogaster
Sequence 2:NP_524679.3 Gene:msn / 44030 FlyBaseID:FBgn0010909 Length:1504 Species:Drosophila melanogaster


Alignment Length:403 Identity:141/403 - (34%)
Similarity:212/403 - (52%) Gaps:49/403 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LPDPTDKFEIYEEIAQGVNAKVFRAKELDNDRIVALKIQHYDEEHQVSIEEEYRTLRDYCDHPNL 73
            |.||...||:.|.:..|...:|::.:.....::.|:|:....|:.:..|:.|...|:.|.:|.|:
  Fly    25 LKDPAGIFELIEVVGNGTYGQVYKGRHTKTGQLAAIKVMDVTEDEEEEIKLEINVLKKYSNHRNI 89

  Fly    74 PEFYGVY-KLSKPNGPDEIWFVMEYCAGGTAVDMVNKLLKLDRRMREEHIAYIIRETCRAAIELN 137
            ..:||.: |.|.|...|::|.|||||..|:..|:| |..| .:.::||.||||.||..|....|:
  Fly    90 ATYYGAFIKKSPPGKDDQLWLVMEYCGAGSVTDLV-KSTK-GQSLKEEWIAYICREILRGLSYLH 152

  Fly   138 RNHVLHRDIRGDNILLTKNGRVKLCDFGLSRQVDSTLGKRGTCIGSPCWMAPEVVSAMESREPDI 202
            .|.|:||||:|.|:|||.|..|||.|||:|.|:|.|:|:|.|.||:|.||||||::..|:  ||.
  Fly   153 SNKVIHRDIKGQNVLLTDNAEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIACDEN--PDA 215

  Fly   203 TV--RADVWALGITTIELADGKPPFADMHPTRAMFQIIRNPPPTLMRPTNWSQQINDFISESLEK 265
            |.  |:|:|:||||.:|:|:.:||..|:||.||:|.|.||.||.| :...||::.:.||...|.|
  Fly   216 TYDNRSDLWSLGITALEMAESQPPLCDLHPMRALFLIPRNSPPRL-KSKKWSKKFHGFIDTVLVK 279

  Fly   266 NAENRPMMVEMVEHPFLTELIENEDEMRSDIAEMLELSRDVKTLYKEPELFVDRGYVKRFDEKPE 330
            :...||....:::|.|:      :|:         ...|.|:...|:   .:|| ..||..||..
  Fly   280 DYHQRPYTENLLKHGFI------KDQ---------PTDRQVRIQLKD---HIDR-CKKRKQEKER 325

  Fly   331 KMYPEDLAALENPVDENIIESLRHRILMGESYSFI---GDILLSLNSNEIKQEFPQEFHAKYRFK 392
            :.|  ..:..:|..||        ..|.||..|.:   |...|..|..:|::.         |..
  Fly   326 EDY--RYSGSDNDDDE--------PQLAGEHSSIVQAPGGDTLRRNFQQIQEG---------RLA 371

  Fly   393 SRSENQPHIFSVA 405
            :..:.|.|:.:.|
  Fly   372 AEQQQQHHLMAQA 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaCNP_523503.2 STKc_myosinIII_N_like 9..282 CDD:270785 114/275 (41%)
S_TKc 16..282 CDD:214567 111/268 (41%)
MYSc 327..1034 CDD:214580 18/82 (22%)
MYSc_Myo21 346..1022 CDD:276848 13/63 (21%)
msnNP_524679.3 STKc_myosinIII_N_like 25..296 CDD:270785 114/275 (41%)
S_TKc 32..296 CDD:214567 111/268 (41%)
CNH 1183..1484 CDD:214481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0587
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.