DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaC and Plekhh3

DIOPT Version :9

Sequence 1:NP_523503.2 Gene:ninaC / 34012 FlyBaseID:FBgn0002938 Length:1501 Species:Drosophila melanogaster
Sequence 2:XP_006247425.1 Gene:Plekhh3 / 360634 RGDID:1304854 Length:871 Species:Rattus norvegicus


Alignment Length:142 Identity:32/142 - (22%)
Similarity:46/142 - (32%) Gaps:52/142 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly  1311 VHRSGS----RRNSLKGYAAPPPP---PPPMPSSNYYRNNPNQQQR------------------- 1349
            ||..|:    ||::....|.|.|.   |.|:||       |:...|                   
  Rat    13 VHLLGALRQRRRHAWPDLALPLPSLPGPRPIPS-------PSASARAKECGEAGWAAGTPGFALL 70

  Fly  1350 ----NYQQRSSYPPSDPVR---ELQNMARNEGDNS---------EDPPFNFKAMLRKTNYPR-GS 1397
                ::.|....||.||.|   ::..:....|.:.         ||  |:....||:.:.|. ||
  Rat    71 IVHEHWGQMRELPPRDPGRGEKDILELGSASGTSQRKSSGRWPFED--FSLSCHLRQNSLPSLGS 133

  Fly  1398 ETNTYDFNNRRG 1409
            ...|.....|.|
  Rat   134 LDVTLTQPTRNG 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaCNP_523503.2 STKc_myosinIII_N_like 9..282 CDD:270785
S_TKc 16..282 CDD:214567
MYSc 327..1034 CDD:214580
MYSc_Myo21 346..1022 CDD:276848
Plekhh3XP_006247425.1 PH3_MyoX-like 161..285 CDD:270109
PH 173..276 CDD:278594
MyTH4 365..474 CDD:279165
UBQ 486..>536 CDD:294102
FERM_B-lobe 591..>630 CDD:298919
PH-like 738..825 CDD:302622
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4229
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.