DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and WNT3A

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_011542621.1 Gene:WNT3A / 89780 HGNCID:15983 Length:446 Species:Homo sapiens


Alignment Length:405 Identity:137/405 - (33%)
Similarity:190/405 - (46%) Gaps:111/405 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 CRSVPGLTKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCSSLSTKSRNPHAS----- 135
            |.|:|||...|:..|....::..:..||:.:.|:|||.||:..||||:::       |.|     
Human    42 CASIPGLVPKQLRFCRNYVEIMPSVAEGIKIGIQECQHQFRGRRWNCTTV-------HDSLAIFG 99

  Fly   136 SLLKKGYRESAFAFAISAAGVAHSVARACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQ 200
            .:|.|..|||||..||::||||.:|.|:|::|....|||                          
Human   100 PVLDKATRESAFVHAIASAGVAFAVTRSCAEGTAAICGC-------------------------- 138

  Fly   201 YLETNQILTPEEEKKYERSKIASRWKWGGCSHNMDFGVEYSKLFLDCREKAGDIQSKINLHNNHA 265
                        ..:::.|. ...|||||||.:::||...|:.|.|.||...|.:|.:|.|||.|
Human   139 ------------SSRHQGSP-GKGWKWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEA 190

  Fly   266 GRIAVSNNMEFRCKCHGMSGSCQLKTCWKSAPDFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVL 330
            ||.|::::|..:|||||:||||::||||.|.|||..:|..||.::..|          .|.||  
Human   191 GRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSA----------SEMVV-- 243

  Fly   331 KRARNKKSNGGSGSGSTSPDLDSTDASGGHDDGGTGDSETRRHDELGVERGT--RQPSADKNAAR 393
              .::::|.|.                          .||.|      .|.|  :.|:       
Human   244 --EKHRESRGW--------------------------VETLR------PRYTYFKVPT------- 267

  Fly   394 MARKLETSLFYYQRSPNFCERDLGADIQGTVGRKCNRNTTTSDGCTSLCCGRGHSQVIQRRAERC 458
                 |..|.||:.||||||.:......||..|.||.::...|||..|||||||:...:||.|:|
Human   268 -----ERDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARAERRREKC 327

  Fly   459 HCKFQWCCNVECEEC 473
            .|.|.|||.|.|:||
Human   328 RCVFHWCCYVSCQEC 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 127/390 (33%)
WNT3AXP_011542621.1 WNT1 44..352 CDD:128408 136/403 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152253
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.