DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and wnt4b

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_571575.1 Gene:wnt4b / 791993 ZFINID:ZDB-GENE-000411-1 Length:358 Species:Danio rerio


Alignment Length:450 Identity:142/450 - (31%)
Similarity:198/450 - (44%) Gaps:126/450 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LIVMII----LACCTRWL------YGLP-DGRATCRSVPGLTKDQVELCYKASDVTAAALEGLDM 106
            |:::::    ||..|.||      ...| .|...|..:.||:..||.:|....:|..:..:..:|
Zfish    13 LLLLLLWAAHLAMATNWLSLARLSRSRPVSGAEPCGRLRGLSPGQVGVCRARGEVMESVRKASEM 77

  Fly   107 AIRECQIQFQWHRWNCSSLSTKSRNPHA-SSLLKKGYRESAFAFAISAAGVAHSVARACSQGRLM 170
            .|.|||.||:..||||   ||..|..:. ..::.:|.||:||..|:|:|.||.:|.|.||:|.|.
Zfish    78 VIEECQHQFRNRRWNC---STTPRGINVFGRVMNQGTREAAFVHALSSAAVAVAVTRGCSRGELE 139

  Fly   171 SCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETNQILTPEEEKKYERSKIASRWKWGGCSHNMD 235
            .||||    ||...                       ::||            .::|.|||.|:.
Zfish   140 RCGCD----RKVRG-----------------------VSPE------------GFQWSGCSDNLS 165

  Fly   236 FGVEYSKLFLDCREKAGDIQS---KINLHNNHAGRIAVSNNMEFRCKCHGMSGSCQLKTCWKSAP 297
            :||.:|:.|:|..|:|..:.|   .:|:|||.|||.|:.:||:..|||||:||||:|:||||..|
Zfish   166 YGVAFSQTFVDEPERAKGMSSGRPLMNIHNNEAGRKAILHNMQVECKCHGVSGSCELRTCWKVMP 230

  Fly   298 DFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVLKRARNKKSNGGSGSGSTSPDLDSTDASGGHDD 362
            .|..||.|||..|..|..|..:.:|:...::                                  
Zfish   231 PFRRVGAVLKEHFDGATEVRLTRVGSRTALL---------------------------------- 261

  Fly   363 GGTGDSETRRHDELGVERGTRQPSADKNAARMARKLETSLFYYQRSPNFCERDLGADIQGTVGRK 427
                               .|.|.....|.|       .|.|...||:||..|....|.||.||:
Zfish   262 -------------------PRDPQVKPPATR-------DLVYLAPSPDFCRLDPDNGIPGTAGRR 300

  Fly   428 CNRNTTTS-DGCTSLCCG----RGHSQVIQRRAERCHCKFQWCCNVECEECHVEEWISIC 482
            ||..:..: |||..||||    .|.::|:|    ||.|||.|||:|.|::|.....|..|
Zfish   301 CNGTSRLAPDGCELLCCGPGFRAGRAEVVQ----RCSCKFSWCCSVRCQQCKNTVLIHTC 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 125/392 (32%)
wnt4bNP_571575.1 wnt 53..357 CDD:278536 131/409 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586747
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48513
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.