DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and WNT9B

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_011523480.1 Gene:WNT9B / 7484 HGNCID:12779 Length:363 Species:Homo sapiens


Alignment Length:401 Identity:116/401 - (28%)
Similarity:176/401 - (43%) Gaps:105/401 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LTKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCSSLSTKSRNPHASSLLKKGYRESA 146
            |::.|.:||.:...:.....:...:.:.|||.||:..||||   |.:.|    ..|||:|::|:|
Human    66 LSRRQKQLCRREPGLAETLRDAAHLGLLECQFQFRHERWNC---SLEGR----MGLLKRGFKETA 123

  Fly   147 FAFAISAAGVAHSVARACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETNQILTPE 211
            |.:|:|:|.:.|::|||||.||:..|.||.:..                      ||:.|     
Human   124 FLYAVSSAALTHTLARACSAGRMERCTCDDSPG----------------------LESRQ----- 161

  Fly   212 EEKKYERSKIASRWKWGGCSHNMDFGVEYSKLFLDCREKAGDIQSKINLHNNHAGRIAVSNNMEF 276
                        .|:||.|..|:.:..::...||..:....|::::.:.||.|.|..||.:.:..
Human   162 ------------AWQWGVCGDNLKYSTKFLSNFLGSKRGNKDLRARADAHNTHVGIKAVKSGLRT 214

  Fly   277 RCKCHGMSGSCQLKTCWKSAPDFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVLKRARNKKSNGG 341
            .|||||:||||.::||||....|...|:|||.::..|:.|..:                      
Human   215 TCKCHGVSGSCAVRTCWKQLSPFRETGQVLKLRYDSAVKVSSA---------------------- 257

  Fly   342 SGSGSTSPDLDSTDASGGHDDGGTGDSETRRHDELGVERGTRQPSADKNAARMARKLETSLFYYQ 406
                       :.:|.|                .|.:....||.|..|..|..:    ..|.|.:
Human   258 -----------TNEALG----------------RLELWAPARQGSLTKGLAPRS----GDLVYME 291

  Fly   407 RSPNFCERDLGADIQGTVGRKCNRNTTTSDGCTSLCCGRGHSQVIQRRAERCHCKFQWCCNVECE 471
            .||:||.....:  .||.||.|:|..:    |:|||||||:....:..|..|||:.||||.|||:
Human   292 DSPSFCRPSKYS--PGTAGRVCSREAS----CSSLCCGRGYDTQSRLVAFSCHCQVQWCCYVECQ 350

  Fly   472 ECHVEEWISIC 482
            :|..||.:..|
Human   351 QCVQEELVYTC 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 107/383 (28%)
WNT9BXP_011523480.1 wnt 66..362 CDD:278536 116/401 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152256
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.