DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and WNT9A

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_003386.1 Gene:WNT9A / 7483 HGNCID:12778 Length:365 Species:Homo sapiens


Alignment Length:405 Identity:124/405 - (30%)
Similarity:189/405 - (46%) Gaps:109/405 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LTKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCSSLSTKSRNPHASSLLKKGYRESA 146
            |.:.|..:|.:...|....:|.:.|:..|||.||::.|||| :|..:.|    :||||:|::|:|
Human    64 LERKQRRMCRRDPGVAETLVEAVSMSALECQFQFRFERWNC-TLEGRYR----ASLLKRGFKETA 123

  Fly   147 FAFAISAAGVAHSVARACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETNQILTPE 211
            |.:|||:||:.|::|:|||.||:..|.||             ::.|.|.::              
Human   124 FLYAISSAGLTHALAKACSAGRMERCTCD-------------EAPDLENRE-------------- 161

  Fly   212 EEKKYERSKIASRWKWGGCSHNMDFGVEYSKLFLDCREKAGDIQSKINLHNNHAGRIAVSNNMEF 276
                        .|:||||..|:.:..::.|.||. |..:.|::::::.|||..|...:...:|.
Human   162 ------------AWQWGGCGDNLKYSSKFVKEFLG-RRSSKDLRARVDFHNNLVGVKVIKAGVET 213

  Fly   277 RCKCHGMSGSCQLKTCWKSAPDFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVLKRARNKKSNGG 341
            .|||||:||||.::|||:....||.|||.|||::..|:.|..:                  :|..
Human   214 TCKCHGVSGSCTVRTCWRQLAPFHEVGKHLKHKYETALKVGST------------------TNEA 260

  Fly   342 SG-SGSTSPDLDSTDASGGHDDGGTGDSETRRHDELGVERGTRQPSADKNAARMARKLETSLFYY 405
            :| :|:.||.......:||.|.                               :.|..|  |.:.
Human   261 AGEAGAISPPRGRASGAGGSDP-------------------------------LPRTPE--LVHL 292

  Fly   406 QRSPNFCERDLGADIQGTVGRKCNRNTTTSDGCTSLCCGRGH---SQVIQRRAERCHCKFQWCCN 467
            ..||:||.  .|....||.||:|:|    ...|.|:||||||   |:|:.|   .|.|:.:|||.
Human   293 DDSPSFCL--AGRFSPGTAGRRCHR----EKNCESICCGRGHNTQSRVVTR---PCQCQVRWCCY 348

  Fly   468 VECEECHVEEWISIC 482
            |||.:|...|.:..|
Human   349 VECRQCTQREEVYTC 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 116/387 (30%)
WNT9ANP_003386.1 Wnt 64..364 CDD:393294 124/405 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..287 8/57 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152271
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.