DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and WNT2B

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_078613.1 Gene:WNT2B / 7482 HGNCID:12781 Length:391 Species:Homo sapiens


Alignment Length:472 Identity:148/472 - (31%)
Similarity:206/472 - (43%) Gaps:120/472 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EQQQLPQQQKQQQEAGSSSSSNSSSNNLVATPATSRHCNLHLIVMIILA-CCTRWLY-GLPDGRA 74
            |..|||.::........|.::...|.   |:......|.|.|:::.:.| ..|.|.| |....|.
Human     9 EAAQLPLRRASAPVPVPSPAAPDGSR---ASARLGLACLLLLLLLTLPARVDTSWWYIGALGARV 70

  Fly    75 TCRSVPGLTKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCSSLSTKSRNPHA--SSL 137
            .|.::|||...|.:||.:..|:..:..||....|||||.||:.|||||::|.    ..|.  ..:
Human    71 ICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTTLD----RDHTVFGRV 131

  Fly   138 LKKGYRESAFAFAISAAGVAHSVARACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYL 202
            :.:..||:||.:|||:|||.|::.||||||.|..|.|||                          
Human   132 MLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDP-------------------------- 170

  Fly   203 ETNQILTPEEEKKYERSKIASR---WKWGGCSHNMDFGVEYSKLFLDCREK-AGDIQSKINLHNN 263
                         |.|.:...:   :.|||||.|:.:||.::|.|:|.:|| ..|.::.:|||||
Human   171 -------------YTRGRHHDQRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNN 222

  Fly   264 HAGRIAVSNNMEFRCKCHGMSGSCQLKTCWKSAPDFHIVGKVLKHQFRKAILVDQSNLGNGEPVV 328
            ..||.||...::..|||||:||||.|:|||::..||.                            
Human   223 RCGRTAVRRFLKLECKCHGVSGSCTLRTCWRALSDFR---------------------------- 259

  Fly   329 VLKRARNKKSNGGSGSGSTSPDLDSTDASGGHDDGGTGDSETRRHDELGVERGTRQPSADKNAAR 393
                                               .|||...||:|. .|:....|..|:..|||
Human   260 -----------------------------------RTGDYLRRRYDG-AVQVMATQDGANFTAAR 288

  Fly   394 MA--RKLETSLFYYQRSPNFCERDLGADIQGTVGRKCNRNTTTSDGCTSLCCGRGHSQVIQRRAE 456
            ..  |...|.|.|:..||::|..|..|...||.||.|::.:..:|||..:|||||:......|..
Human   289 QGYRRATRTDLVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVT 353

  Fly   457 RCHCKFQWCCNVECEEC 473
            :|.|||.|||.|.|:||
Human   354 QCECKFHWCCAVRCKEC 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 123/391 (31%)
WNT2BNP_078613.1 wnt 74..380 CDD:306592 131/404 (32%)
WNT-core domain 107..379 119/371 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152259
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.