DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and WNT8B

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_003384.2 Gene:WNT8B / 7479 HGNCID:12789 Length:351 Species:Homo sapiens


Alignment Length:402 Identity:125/402 - (31%)
Similarity:170/402 - (42%) Gaps:117/402 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LTKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCSSLSTKSRNPHASSLLKKGYRESA 146
            :|..:..|.| :|.|.|.|..|    |.||:.||.|.||||...:.: .:.|..  |:...||:|
Human    30 MTGPKAYLIY-SSSVAAGAQSG----IEECKYQFAWDRWNCPERALQ-LSSHGG--LRSANRETA 86

  Fly   147 FAFAISAAGVAHSVARACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETNQILTPE 211
            |..|||:|||.:::.|.||.|...:||||.:.|.:...:.                         
Human    87 FVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQG------------------------- 126

  Fly   212 EEKKYERSKIASRWKWGGCSHNMDFGVEYSKLFLDCREKAGDIQSKINLHNNHAGRIAVSNNMEF 276
                         |.|||||.|:.||...||.|:|..|...|.::.:|||||.|||.||...|:.
Human   127 -------------WLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKR 178

  Fly   277 RCKCHGMSGSCQLKTCWKSAPDFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVLKRARNKKSNGG 341
            .|||||:||||..:|||...|:|..||..||.::..|:.||           :|:.|    .|..
Human   179 TCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVD-----------LLQGA----GNSA 228

  Fly   342 SGSGSTSPDLDSTDASGGHDDGGTGDSETRRHDELGVERGTRQPSADKNAARMARKLETSLFYYQ 406
            :|.|:.:....|.                          .||:                 |.:.:
Human   229 AGRGAIADTFRSI--------------------------STRE-----------------LVHLE 250

  Fly   407 RSPNFCERDLGADIQGTVGRKCNRNTTT-----SDGCTSLC--CGRGHSQVIQRRAE---RCHCK 461
            .||::|..:....:.||.||:|.|....     ...|..||  ||..   |.:||||   .|:||
Human   251 DSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLA---VEERRAETVSSCNCK 312

  Fly   462 FQWCCNVECEEC 473
            |.|||.|.||:|
Human   313 FHWCCAVRCEQC 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 119/393 (30%)
WNT8BNP_003384.2 WNT1 23..333 CDD:128408 125/402 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152277
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.