DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and WNT7A

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_004616.2 Gene:WNT7A / 7476 HGNCID:12786 Length:349 Species:Homo sapiens


Alignment Length:400 Identity:137/400 - (34%)
Similarity:192/400 - (48%) Gaps:100/400 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 CRSVPGLTKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCSSLSTKSRNPHASSLLKK 140
            |..:|||...|..:|....|......||..|.:.|||.||:..|||||:|..::   .....||.
Human    38 CNKIPGLAPRQRAICQSRPDAIIVIGEGSQMGLDECQFQFRNGRWNCSALGERT---VFGKELKV 99

  Fly   141 GYRESAFAFAISAAGVAHSVARACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETN 205
            |.||:||.:||.||||||::..||:||.|..|||                 ||||          
Human   100 GSREAAFTYAIIAAGVAHAITAACTQGNLSDCGC-----------------DKEK---------- 137

  Fly   206 QILTPEEEKKYERSKIASRWKWGGCSHNMDFGVEYSKLFLDCREKAGDIQSKINLHNNHAGRIAV 270
                   :.:|.|.:   .|||||||.::.:|:.::|:|:|.||...:.::.:|||||.|||..:
Human   138 -------QGQYHRDE---GWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLMNLHNNEAGRKIL 192

  Fly   271 SNNMEFRCKCHGMSGSCQLKTCWKSAPDFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVLKRARN 335
            ..||:..|||||:||||..||||.:.|.|..:|.|||.::.:|:.|        |||   :.:||
Human   193 EENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHV--------EPV---RASRN 246

  Fly   336 KKSNGGSGSGSTSPDLDSTDASGGHDDGGTGDSETRRHDELGVER--GTRQPSADKNAARMARKL 398
            |                                   |...|.:::  ..|:|            :
Human   247 K-----------------------------------RPTFLKIKKPLSYRKP------------M 264

  Fly   399 ETSLFYYQRSPNFCERDLGADIQGTVGRKCNRNTTTSDGCTSLCCGRGHSQVIQRRAERCHCKFQ 463
            :|.|.|.::|||:||.|......||.||.||:....:.||..:|||||::.....|..:|:|||.
Human   265 DTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQASGCDLMCCGRGYNTHQYARVWQCNCKFH 329

  Fly   464 WCCNVECEEC 473
            |||.|:|..|
Human   330 WCCYVKCNTC 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 129/385 (34%)
WNT7ANP_004616.2 Wnt_Wnt7a 32..349 CDD:381723 136/399 (34%)
Disordered linker. /evidence=ECO:0000269|PubMed:30026314 238..266 11/85 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152262
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.690

Return to query results.
Submit another query.