DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and wnt7aa

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001020711.1 Gene:wnt7aa / 565714 ZFINID:ZDB-GENE-051129-1 Length:349 Species:Danio rerio


Alignment Length:409 Identity:140/409 - (34%)
Similarity:192/409 - (46%) Gaps:100/409 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 CRSVPGLTKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCSSLSTKSRNPHASSLLKK 140
            |..:|||...|..:|....|......||..|.|.|||.||:..|||||:|..::   .....||.
Zfish    38 CNKIPGLAPRQRTICQSRPDAIIVIGEGAQMGINECQFQFKNGRWNCSALGERT---VFGKELKV 99

  Fly   141 GYRESAFAFAISAAGVAHSVARACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETN 205
            |.:|:||.:||.||||||::..||:||.|..|||                 ||||:.|..     
Zfish   100 GSKEAAFTYAIIAAGVAHAITAACTQGTLSGCGC-----------------DKEKQGFYN----- 142

  Fly   206 QILTPEEEKKYERSKIASRWKWGGCSHNMDFGVEYSKLFLDCREKAGDIQSKINLHNNHAGRIAV 270
                 :||          .|||||||.::.:|:.:||:|||.||...:.::.:|||||..||..:
Zfish   143 -----QEE----------GWKWGGCSADIRYGLSFSKVFLDAREIKQNARTLMNLHNNEVGRKIL 192

  Fly   271 SNNMEFRCKCHGMSGSCQLKTCWKSAPDFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVLKRARN 335
            ..||...|||||:||||..||||.:.|.|..:|.:||.::..|:.|        |||   :.:||
Zfish   193 EKNMRLECKCHGVSGSCTTKTCWTTLPKFRQLGYILKERYNHAVHV--------EPV---RASRN 246

  Fly   336 KKSNGGSGSGSTSPDLDSTDASGGHDDGGTGDSETRRHDELGVER--GTRQPSADKNAARMARKL 398
            |                                   |...|.|::  ..|:|            :
Zfish   247 K-----------------------------------RPAFLKVKKPYSYRKP------------M 264

  Fly   399 ETSLFYYQRSPNFCERDLGADIQGTVGRKCNRNTTTSDGCTSLCCGRGHSQVIQRRAERCHCKFQ 463
            :|.|.|.::|||:||.|......||.||.||:....::||..:|||||::.....|..:|:|||.
Zfish   265 DTDLVYIEKSPNYCEADPVTGSMGTQGRICNKTAQHTNGCDLMCCGRGYNTHQYSRVWQCNCKFL 329

  Fly   464 WCCNVECEECHVEEWISIC 482
            |||.|:|..|.....:..|
Zfish   330 WCCYVKCNTCSERTEVYTC 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 131/385 (34%)
wnt7aaNP_001020711.1 wnt 44..349 CDD:278536 137/403 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586737
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.