DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and wnt9b

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001131132.1 Gene:wnt9b / 565677 ZFINID:ZDB-GENE-080201-1 Length:358 Species:Danio rerio


Alignment Length:461 Identity:129/461 - (27%)
Similarity:203/461 - (44%) Gaps:132/461 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PATSRHCNLHLIVMIILACCTRWLYGLPDGRATCRSVPG--------------------LTKDQV 87
            |.|:  |.|.||.:.||.......:|| .||.....:||                    ||:.|.
Zfish     6 PRTA--CPLRLIALCILLSHAAAYFGL-TGREPLVFLPGPFANEPTNGKAHLKQCEQMTLTRRQK 67

  Fly    88 ELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCSSLSTKSRNPHASSLLKKGYRESAFAFAIS 152
            .||.:...:.....|.:.:::.||:.||:..|||||.       ....||||:|::|:||..|:|
Zfish    68 RLCRREPGLAETLRESVRLSLLECRYQFRNERWNCSM-------DGRGSLLKRGFKETAFLLAVS 125

  Fly   153 AAGVAHSVARACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETNQILTPEEEKKYE 217
            :|.::|::|:|||.||:..|.||.:..                   ||:.|.             
Zfish   126 SAALSHALAKACSSGRMERCTCDDSPG-------------------LQHREA------------- 158

  Fly   218 RSKIASRWKWGGCSHNMDFGVEYSKLFLDCREKAGDIQSKINLHNNHAGRIAVSNNMEFRCKCHG 282
                   |:||.|..|:.:..::.|.||..:..:.|::::|:.||.:.|..||.:.::..|||||
Zfish   159 -------WQWGVCGDNLKYSTKFLKKFLGQKRVSKDLRAQIDAHNINVGIRAVKSGLKTTCKCHG 216

  Fly   283 MSGSCQLKTCWKSAPDFHIVGKVLKHQFRKAILVDQ-SNLGNGEPVVVLKRARNKKSNGGSGSGS 346
            :||||.::||||....|...|.:||:::..|:.|.. :|...||                     
Zfish   217 VSGSCAVRTCWKQLSPFQDTGHLLKYRYDTAVRVHSVTNSATGE--------------------- 260

  Fly   347 TSPDLDSTDASGGHDDGGTGDSETRRHDELGVERGTRQPSADKNAARMARKLETSLFYYQRSPNF 411
                   |:.:|           .|||                 :..:.|...|.|.:.:.||:|
Zfish   261 -------TELAG-----------PRRH-----------------SITLPRPRPTELVFLEESPSF 290

  Fly   412 CERDLGADIQGTVGRKCNRNTTTSDGCTSLCCGRGHSQVIQRRAERCHCKFQWCCNVECEECHVE 476
            |.....:  .||.||.|:::|:    |:|||||||::..::.....|||:.:|||:|||:.|..|
Zfish   291 CRPSRYS--PGTAGRPCSKDTS----CSSLCCGRGYNTALRLTTLSCHCQVRWCCHVECQTCLRE 349

  Fly   477 EWISIC 482
            |.:..|
Zfish   350 EEVYTC 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 106/384 (28%)
wnt9bNP_001131132.1 Wnt_Wnt9b 62..356 CDD:381728 115/402 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586729
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.