DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and WNT4

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_011539899.1 Gene:WNT4 / 54361 HGNCID:12783 Length:373 Species:Homo sapiens


Alignment Length:402 Identity:135/402 - (33%)
Similarity:195/402 - (48%) Gaps:105/402 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 TCRSVPGLTKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCSSLSTKSRNPHASSLLK 139
            ||..:.||.:.||::|.:..:|..:...|..:||.|||.||:..|||||:|.:.   |....::.
Human    64 TCEKLKGLIQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSL---PVFGKVVT 125

  Fly   140 KGYRESAFAFAISAAGVAHSVARACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLET 204
            :|.||:||.:|||:||||.:|.||||.|.|..||||.|::.                        
Human   126 QGTREAAFVYAISSAGVAFAVTRACSSGELEKCGCDRTVHG------------------------ 166

  Fly   205 NQILTPEEEKKYERSKIASRWKWGGCSHNMDFGVEYSKLFLDCREK---AGDIQSKINLHNNHAG 266
               ::|:            .::|.|||.|:.:||.:|:.|:|.||:   |...::.:|||||.||
Human   167 ---VSPQ------------GFQWSGCSDNIAYGVAFSQSFVDVRERSKGASSSRALMNLHNNEAG 216

  Fly   267 RIAVSNNMEFRCKCHGMSGSCQLKTCWKSAPDFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVLK 331
            |.|:..:|...|||||:||||::||||::.|.|..||..||.:|..|..|:...:|:...:|   
Human   217 RKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDGATEVEPRRVGSSRALV--- 278

  Fly   332 RARNKKSNGGSGSGSTSPDLDSTDASGGHDDGGTGDSETRRHDELGVERGTRQPSADKNAARMAR 396
             .||.:.                                             :|..|::      
Human   279 -PRNAQF---------------------------------------------KPHTDED------ 291

  Fly   397 KLETSLFYYQRSPNFCERDLGADIQGTVGRKCNRNTTTSDGCTSLCCGRGHSQVIQRRAERCHCK 461
                 |.|.:.||:|||:|:.:.:.||.||.||:.:...|||..||||||........||||.||
Human   292 -----LVYLEPSPDFCEQDMRSGVLGTRGRTCNKTSKAIDGCELLCCGRGFHTAQVELAERCSCK 351

  Fly   462 FQWCCNVECEEC 473
            |.|||.|:|.:|
Human   352 FHWCCFVKCRQC 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 127/386 (33%)
WNT4XP_011539899.1 wnt 71..373 CDD:278536 132/395 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152283
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.