DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and WNT16

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_476509.1 Gene:WNT16 / 51384 HGNCID:16267 Length:365 Species:Homo sapiens


Alignment Length:458 Identity:133/458 - (29%)
Similarity:196/458 - (42%) Gaps:124/458 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SRHCNLHLIVMIILACCTR----WL----YGLPDGRATCRSVPGLTKDQVELCYKASDVTAAALE 102
            :|.|.|...::::.....:    ||    :|:|: :..|.::| |...|.|||.:...:..:..|
Human    10 ARLCALWAALLVLFPYGAQGNWMWLGIASFGVPE-KLGCANLP-LNSRQKELCKRKPYLLPSIRE 72

  Fly   103 GLDMAIRECQIQFQWHRWNCSSLSTKSRNPHASS-----LLKKGYRESAFAFAISAAGVAHSVAR 162
            |..:.|:||..||:..||||...:..:..|..:|     .|..|.:|:||.:|:.|||:.|||.|
Human    73 GARLGIQECGSQFRHERWNCMITAAATTAPMGASPLFGYELSSGTKETAFIYAVMAAGLVHSVTR 137

  Fly   163 ACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETNQILTPEEEKKYERSKIASRWKW 227
            :||.|.:..|.||.|:.                                     .....:..|.|
Human   138 SCSAGNMTECSCDTTLQ-------------------------------------NGGSASEGWHW 165

  Fly   228 GGCSHNMDFGVEYSKLFLD-----CREKAGDIQSKINLHNNHAGRIAVSNNMEFRCKCHGMSGSC 287
            ||||.::.:|:.:|:.|||     ...|...:...:|||||.|||.||:..|...|:|||:||||
Human   166 GGCSDDVQYGMWFSRKFLDFPIGNTTGKENKVLLAMNLHNNEAGRQAVAKLMSVDCRCHGVSGSC 230

  Fly   288 QLKTCWKSAPDFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVLKRARNKKSNGGSGSGSTSPDLD 352
            .:|||||:...|..:|.:||.::..:|.:.                                  |
Human   231 AVKTCWKTMSSFEKIGHLLKDKYENSIQIS----------------------------------D 261

  Fly   353 STDASGGHDDGGTGDSETRRHDELGVERGTRQPSADKNAARMARKL---ETSLFYYQRSPNFCER 414
            .|                        :|..|:...|:      ||:   :..|.|..:|||:|..
Human   262 KT------------------------KRKMRRREKDQ------RKIPIHKDDLLYVNKSPNYCVE 296

  Fly   415 DLGADIQGTVGRKCNRNTTTSDGCTSLCCGRGHSQVIQRRAERCHCKFQWCCNVECEECHVEEWI 479
            |....|.||.||:|||.:..:|||..||||||::..:.|..|||.|||.|||.|.|..|.....:
Human   297 DKKLGIPGTQGRECNRTSEGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTDV 361

  Fly   480 SIC 482
            ..|
Human   362 HTC 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 118/396 (30%)
WNT16NP_476509.1 wnt 52..365 CDD:306592 124/414 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.