DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and gtpbp4

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_002935223.2 Gene:gtpbp4 / 496593 XenbaseID:XB-GENE-962819 Length:633 Species:Xenopus tropicalis


Alignment Length:236 Identity:46/236 - (19%)
Similarity:72/236 - (30%) Gaps:79/236 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 PTINRKTLNKNLRQSLDKEKKQFLQYLETN-------------QILTPEEEKKYERSKIASRWKW 227
            |.|....|.:..|...|..||:..:.:|..             .::.|.|    ...|:...|: 
 Frog   375 PFIPEGALARKKRMVTDAPKKRLEKDIEVEMGDDYILDLQKYWDLMNPSE----RTDKVPEIWQ- 434

  Fly   228 GGCSHNM-DF-------GVEYSKLFLDCREKAGDIQSKINLHNNHAGRIAVSNNMEFRCKCHGMS 284
               .||: |:       .:|..:...:.||.||:..|.|...:...        .|.|.....:.
 Frog   435 ---GHNIADYIDPEIMKKLEELEKEEELREGAGEYDSDIESEDEEM--------TEIRELAQQIR 488

  Fly   285 GSCQLKTCWKSAPDFHI--VGKVLKHQFRKAILVDQSNLG------------------------- 322
            ...:||.......|.|.  :.:.:|...||::..:.|:||                         
 Frog   489 EKKKLKILESKEKDIHAPRLPRTVKKVQRKSLEKEMSSLGLDMTEKDQTHYAAQARSRSLQRKRK 553

  Fly   323 --NGEPVVVLKRARNKKSNGGSGSGSTSPDLDSTDASGGHD 361
              ..||.|...|:|         |.|.:|    .|.||..|
 Frog   554 RDESEPPVSAARSR---------SSSKTP----RDQSGMRD 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 46/236 (19%)
gtpbp4XP_002935223.2 Nog1 5..345 CDD:224009
NOGCT 395..446 CDD:369719 9/58 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165170854
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.