DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and wntD

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_650272.1 Gene:wntD / 41633 FlyBaseID:FBgn0038134 Length:309 Species:Drosophila melanogaster


Alignment Length:405 Identity:91/405 - (22%)
Similarity:135/405 - (33%) Gaps:147/405 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 TKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCSS--LSTKSRNPHASSLLKKGYRES 145
            |:.|..|.::  |:|.   :||..|:..||..|||.||||.|  ...|:..|..:|    ..||.
  Fly    28 TQFQAPLSWE--DITG---KGLKQALDSCQQSFQWQRWNCPSQDFVQKNSKPEENS----PNRED 83

  Fly   146 AFAFAISAAGVAHSVARACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETNQILTP 210
            .:..|||.|.:.|::.:.|:.|.:..|||                            ..|.:..|
  Fly    84 VYVAAISMAAIVHTLTKDCANGVIAGCGC----------------------------TENALNVP 120

  Fly   211 EEEKKYERSKIASRWKWGGCSHNMDFGVE-YSKLFLDCREKAGDIQSKINLHNNHAGRIAVSNNM 274
                               |:|.....:| |.|.|       |.....|. ||.......:..::
  Fly   121 -------------------CAHEPTKALEQYEKHF-------GSGSGAIG-HNRRVVGALLQRSL 158

  Fly   275 EFRCKCH---GMSGSCQLKTCWKSAPDFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVLKRARNK 336
            |..|:|.   .:.|.||.:.|......|..:.:.|...:..||.::                   
  Fly   159 EQECRCKQPGAVQGECQEEECVAVLKPFEAIAQDLLQMYDDAIQLE------------------- 204

  Fly   337 KSNGGSGSGSTSPDLDSTDASGGHDDGGTGDSETRRHDELGVERGTRQPSADKNAARMARKLE-T 400
                                                             .|..|...|.:.:. .
  Fly   205 -------------------------------------------------GASSNLKIMWQNIPLD 220

  Fly   401 SLFYYQRSPNFCERDLGADIQGTVGRKCNRNTTTS----DGCTSLC--CG-RGHSQVIQRRAERC 458
            ||.:.|.|||:||||.....:||.||:|:::.:.|    ..|..||  || |..||.: |...||
  Fly   221 SLVFMQDSPNYCERDATGLWKGTRGRQCSKDGSGSLEERLSCQQLCRVCGYRVRSQHV-RTERRC 284

  Fly   459 HCKFQWCCNVECEEC 473
            :||..|...::|:.|
  Fly   285 NCKLVWGFRLQCDVC 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 89/396 (22%)
wntDNP_650272.1 wnt 41..308 CDD:302926 86/390 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12027
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.