DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and Wnt2

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_476810.1 Gene:Wnt2 / 35975 FlyBaseID:FBgn0004360 Length:352 Species:Drosophila melanogaster


Alignment Length:406 Identity:136/406 - (33%)
Similarity:194/406 - (47%) Gaps:101/406 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 CRSVPGLTKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCSSLSTKSRNPHASSLLKK 140
            |..:||||..|..:|.:..|...|..||..:..:|||.||:.||||||.:..::...|   ::..
  Fly    30 CGRIPGLTPGQRNMCREMPDALIALGEGHQLGAQECQHQFRGHRWNCSEVWQRNVFAH---VIPT 91

  Fly   141 GYRESAFAFAISAAGVAHSVARACSQGRLMSCGCD------PTINRKTLNKNLRQSLDKEKKQFL 199
            ..||:|:.:||::||.|::|..||::|.:.:||||      ||...                   
  Fly    92 ASREAAYTYAIASAGAAYAVTAACARGNISTCGCDVRHKATPTGGG------------------- 137

  Fly   200 QYLETNQILTPEEEKKYERSKIASRWKWGGCSHNMDFGVEYSKLFLDCREKAGDIQSKINLHNNH 264
                     ||:|.           |||||||.::|||:.|::.|:|.||...|.::.:|||||.
  Fly   138 ---------TPDEP-----------WKWGGCSADVDFGMRYARRFMDARELERDSRTLMNLHNNR 182

  Fly   265 AGRIAVSNNMEFRCKCHGMSGSCQLKTCWKSAPDFHIVGK--VLKHQFRKAILVDQSNLGNGEPV 327
            |||..|...:...|||||:||||.:||||||.|.|.:||.  :||:|..|.:...:...|     
  Fly   183 AGRTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAVKGKRG----- 242

  Fly   328 VVLKRARNKKSNGGSGSGSTSPDLDSTDASGGHDDGGTGDSETRRHDELGVERGTRQPSADKNAA 392
              |:...::|.:.|: :.:..|.||                                        
  Fly   243 --LRLVLSRKKHAGT-ARAQKPVLD---------------------------------------- 264

  Fly   393 RMARKLETSLFYYQRSPNFCERDLGADIQGTVGRKCNRNTTTSDGCTSLCCGRGHSQVIQRRAER 457
             ..:::|  |.|.:.|||:|||.|....|||.||.|.|.......|..|||||||:....||..:
  Fly   265 -WPKRME--LIYLEASPNYCERSLQTGSQGTSGRTCQRTGHGPQSCDLLCCGRGHNTQHIRRTTQ 326

  Fly   458 CHCKFQWCCNVECEEC 473
            |.|:|:|||.|:|:||
  Fly   327 CRCQFRWCCEVKCDEC 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 127/391 (32%)
Wnt2NP_476810.1 wnt 36..352 CDD:278536 133/400 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456825
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D48378at7147
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12027
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.