DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and Wnt6

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:NP_001101696.1 Gene:Wnt6 / 316526 RGDID:1304559 Length:365 Species:Rattus norvegicus


Alignment Length:442 Identity:140/442 - (31%)
Similarity:194/442 - (43%) Gaps:101/442 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 IVMIILACCTR-----WLYGLP---DGRATCRSVPGLTKDQVELCYKASDVTAAALEGLDMAIRE 110
            :::::|.|...     |..|.|   |..:.||....|...|.|||....:|.|....|..:.:||
  Rat    11 LLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRE 75

  Fly   111 CQIQFQWHRWNCSSLSTKSRNPHASS---LLKKGYRESAFAFAISAAGVAHSVARACSQGRLMSC 172
            ||.||::.||||||        |:.:   :|::..||:||.|||:|||.:|:|.:|||.|.|:.|
  Rat    76 CQFQFRFRRWNCSS--------HSKAFGRVLQQDIRETAFVFAITAAGASHAVTQACSMGELLQC 132

  Fly   173 GCDPTINRKTLNKNLRQSLDKEKKQFLQYLETNQILTPEEEKKYERSKIASRWKWGGCSHNMDFG 237
            ||.....|....                  .:..:.||...........::.|:||||..::|||
  Rat   133 GCQAPRGRAPPR------------------PSGLLGTPGPPGPTGSPDASAAWEWGGCGDDVDFG 179

  Fly   238 VEYSKLFLDCREK--AGDIQSKINLHNNHAGRIAVSNNMEFRCKCHGMSGSCQLKTCWKSAPDFH 300
            .|.|:||:|.:.|  .|||::.:.||||.|||:||.::....|||||:||||.|:|||:..|.|.
  Rat   180 DEKSRLFMDAQHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFR 244

  Fly   301 IVGKVLKHQFRKAILVDQSNLGNGEPVVVLKRARNKKSNGGSGSGSTSPDLDSTDASGGHDDGGT 365
            .||..|..:|..|..|    :|..:...:|...|..|..|                         
  Rat   245 EVGARLLERFHGASRV----MGTNDGKALLPAVRTLKPPG------------------------- 280

  Fly   366 GDSETRRHDELGVERGTRQPSADKNAARMARKLETSLFYYQRSPNFCERDLGADIQGTVGRKCNR 430
                                             ...|.|...||:||..:......||.||.||.
  Rat   281 ---------------------------------RADLLYAADSPDFCAPNRRTGSPGTRGRACNS 312

  Fly   431 NTTTSDGCTSLCCGRGHSQVIQRRAERCHCKFQWCCNVECEECHVEEWISIC 482
            :.....||..|||||||.|...:..|.|.|:|.|||.|:|..|.|.:.:|:|
  Rat   313 SAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLC 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 124/388 (32%)
Wnt6NP_001101696.1 Wnt_Wnt6 35..365 CDD:381712 135/418 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.