DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wnt10 and Wnt7b

DIOPT Version :9

Sequence 1:NP_609109.3 Gene:Wnt10 / 34011 FlyBaseID:FBgn0031903 Length:483 Species:Drosophila melanogaster
Sequence 2:XP_038935225.1 Gene:Wnt7b / 315196 RGDID:1311441 Length:353 Species:Rattus norvegicus


Alignment Length:409 Identity:138/409 - (33%)
Similarity:194/409 - (47%) Gaps:100/409 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 CRSVPGLTKDQVELCYKASDVTAAALEGLDMAIRECQIQFQWHRWNCSSLSTKSRNPHASSLLKK 140
            |..:|||...|..:|....|......||..|.|.|||.||::.|||||:|..|:   .....|:.
  Rat    42 CNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGIDECQHQFRFGRWNCSALGEKT---VFGQELRV 103

  Fly   141 GYRESAFAFAISAAGVAHSVARACSQGRLMSCGCDPTINRKTLNKNLRQSLDKEKKQFLQYLETN 205
            |.||:||.:||:||||||:|..|||||.|.:|||                 |:||:.:.     |
  Rat   104 GSREAAFTYAITAAGVAHAVTAACSQGNLSNCGC-----------------DREKQGYY-----N 146

  Fly   206 QILTPEEEKKYERSKIASRWKWGGCSHNMDFGVEYSKLFLDCREKAGDIQSKINLHNNHAGRIAV 270
            |               |..|||||||.::.:|:::|:.|:|.||...:.:..:|||||.|||..:
  Rat   147 Q---------------AEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVL 196

  Fly   271 SNNMEFRCKCHGMSGSCQLKTCWKSAPDFHIVGKVLKHQFRKAILVDQSNLGNGEPVVVLKRARN 335
            .:.|:..|||||:||||..||||.:.|.|..||.:||.::..|:.|:           |::.:| 
  Rat   197 EDRMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVE-----------VVRASR- 249

  Fly   336 KKSNGGSGSGSTSPDLDSTDASGGHDDGGTGDSETRRHDELGVERGTRQPS--ADKNAARMARKL 398
                                                          .|||:  ..|......:.:
  Rat   250 ----------------------------------------------LRQPTFLRIKQLRSYQKPM 268

  Fly   399 ETSLFYYQRSPNFCERDLGADIQGTVGRKCNRNTTTSDGCTSLCCGRGHSQVIQRRAERCHCKFQ 463
            ||.|.|.::|||:||.|......||.||.|||.:..:|||.::|||||::.....:..:|:|||.
  Rat   269 ETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFH 333

  Fly   464 WCCNVECEECHVEEWISIC 482
            |||.|:|..|.....:..|
  Rat   334 WCCFVKCNTCSERTEVFTC 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wnt10NP_609109.3 wnt 82..466 CDD:278536 129/385 (34%)
Wnt7bXP_038935225.1 wnt_Wnt7b 36..353 CDD:381724 138/409 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345763
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3913
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.